BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0260.Seq (796 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 25 0.53 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 25 0.53 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 2.8 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 6.5 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 6.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 8.6 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 25.4 bits (53), Expect = 0.53 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 691 PREPAGWPRGFPGPPRVAS 635 PRE W R F GP R+A+ Sbjct: 592 PREQLTWRRNFHGPHRLAA 610 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 25.4 bits (53), Expect = 0.53 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 691 PREPAGWPRGFPGPPRVAS 635 PRE W R F GP R+A+ Sbjct: 484 PREQLTWRRNFHGPHRLAA 502 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 794 PPIGPGDFPPEGNRVPPGD 738 PP+ P DFP G+ VP G+ Sbjct: 627 PPV-PKDFPQCGDYVPSGN 644 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = -1 Query: 385 ISIRNFQRSTLIFKCSHNKISNTSLITF-----WSLKFSK 281 +S NF+ + + CS+ + + S TF W + FSK Sbjct: 101 VSNNNFKTYSNVTTCSYYSLDDLSEDTFYDIRLWGVSFSK 140 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = -2 Query: 636 PINPPLIRNHAPNGNQVPGAYSGCSXPMA 550 P + + APNG+Q Y+ C A Sbjct: 113 PSSMHMANTAAPNGHQTQVVYASCKLQAA 141 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/29 (31%), Positives = 12/29 (41%) Frame = -2 Query: 636 PINPPLIRNHAPNGNQVPGAYSGCSXPMA 550 P + + APNG+Q Y C A Sbjct: 115 PSSMHMANTAAPNGHQTQVVYDSCKLQAA 143 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,907 Number of Sequences: 336 Number of extensions: 3692 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -