BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0259.Seq (475 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 5.4 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 5.4 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 7.2 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 7.2 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 23 7.2 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 22 9.5 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.0 bits (47), Expect = 5.4 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -3 Query: 320 NL*YPALTILMTGTLPSGADAYSASSVQRLMSKAYLSSKLDR 195 N+ Y +L I +TGT P+ YS S + +S + + + R Sbjct: 881 NIDYSSLFIQLTGTFPT---LYSCVSCHKTVSNRWHHANIHR 919 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.0 bits (47), Expect = 5.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 390 EENQGCGWCLCTICV 434 EE G G C+C +CV Sbjct: 558 EECSGRGQCVCGVCV 572 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 7.2 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 285 RHQYCQSWILQVARQRQTPQTTCHSKS 365 RH ++W+ R + TPQ+ S++ Sbjct: 224 RHLERKAWVASFGRPKMTPQSLLASQT 250 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 7.2 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 Query: 92 AGGEHHHRINMDKYHPGYFG 151 A HHH + +HPG G Sbjct: 153 AAAMHHHHHHPHHHHPGLTG 172 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 22.6 bits (46), Expect = 7.2 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 Query: 105 CSPPALPRPPGCLRCFPI 52 C+PP +P P C P+ Sbjct: 38 CNPPGIPGGPACAGLKPM 55 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 22.2 bits (45), Expect = 9.5 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +2 Query: 107 HHRINMDKYHPGYFGK--LGMRNFHFR 181 +HRI +D+ H FG+ MR+ +R Sbjct: 111 NHRIQLDENHDPLFGRALFAMRDTRWR 137 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,929 Number of Sequences: 2352 Number of extensions: 8136 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41670678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -