BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0258.Seq (828 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.9 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 23 3.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 6.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 6.8 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 22 6.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 6.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 6.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 6.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 6.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 6.8 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.9 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +1 Query: 424 SSSAQDETVPAQDQRANRNAIRLEPPPSTAIW*RRQRARQSTPRTN 561 S+S+ T A N + + PP W +R QST N Sbjct: 172 STSSTSSTEKAGTNNNNSKSSQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 71 LFSVSSLILFFICG 112 LFS+ + +LF ICG Sbjct: 262 LFSIDNALLFSICG 275 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +1 Query: 424 SSSAQDETVPAQDQRANRNAIRLEPPPSTAIW*RRQRARQSTPRTN 561 S+S+ T A N + + PP W +R QST N Sbjct: 172 STSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +1 Query: 424 SSSAQDETVPAQDQRANRNAIRLEPPPSTAIW*RRQRARQSTPRTN 561 S+S+ T A N + + PP W +R QST N Sbjct: 172 STSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 71 LFSVSSLILFFICGN 115 LF++ + +LF ICG+ Sbjct: 346 LFNIDNALLFAICGS 360 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +1 Query: 424 SSSAQDETVPAQDQRANRNAIRLEPPPSTAIW*RRQRARQSTPRTN 561 S+S+ T A N + + PP W +R QST N Sbjct: 172 STSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +1 Query: 424 SSSAQDETVPAQDQRANRNAIRLEPPPSTAIW*RRQRARQSTPRTN 561 S+S+ T A N + + PP W +R QST N Sbjct: 172 STSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +1 Query: 424 SSSAQDETVPAQDQRANRNAIRLEPPPSTAIW*RRQRARQSTPRTN 561 S+S+ T A N + + PP W +R QST N Sbjct: 128 STSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 173 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +1 Query: 424 SSSAQDETVPAQDQRANRNAIRLEPPPSTAIW*RRQRARQSTPRTN 561 S+S+ T A N + + PP W +R QST N Sbjct: 172 STSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +1 Query: 424 SSSAQDETVPAQDQRANRNAIRLEPPPSTAIW*RRQRARQSTPRTN 561 S+S+ T A N + + PP W +R QST N Sbjct: 172 STSSTSSTEKAGTNNNNSKSGQSSNPPQIYPWMKRVHLGQSTVNAN 217 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,249 Number of Sequences: 336 Number of extensions: 4874 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22725411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -