BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0256.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 29 0.11 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 7.5 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 29.1 bits (62), Expect = 0.11 Identities = 19/51 (37%), Positives = 23/51 (45%) Frame = -2 Query: 438 PTLKCYXTFGASXHSLPLEXKRKLLQFTTGSDRVPVGGLCNLNFVIAXNGP 286 P C+ F S E + +LLQF TGS RVP+ G L GP Sbjct: 795 PFASCF--FWQIVESYSPEMRAQLLQFVTGSCRVPLQGFRALQGSTGAVGP 843 Score = 27.5 bits (58), Expect = 0.35 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -1 Query: 265 RAHF-FNVLLLPEYDTRDKLQDRLLKAINYSKGFGL 161 +AH FN L LP YD+ + D+L +A+ + GF + Sbjct: 861 KAHTCFNRLDLPMYDSYQLMYDKLTQAVEETCGFAV 896 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 294 NGPDCDXLPTAHTSSMSYCYPSTTLETNYRT 202 N + + + S + CY S++LET RT Sbjct: 185 NSVEFSYITSGSGSRIDRCYVSSSLETQLRT 215 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,155 Number of Sequences: 2352 Number of extensions: 8185 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -