BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0255.Seq (748 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58086-1|AAC47123.1| 803|Caenorhabditis elegans CUL-4 protein. 30 2.0 U29536-1|AAA68791.3| 840|Caenorhabditis elegans Cullin protein ... 30 2.0 U80848-1|AAB37990.3| 389|Caenorhabditis elegans Hypothetical pr... 29 3.5 Z75531-9|CAA99802.1| 277|Caenorhabditis elegans Hypothetical pr... 28 6.1 AY728060-1|AAU43721.1| 277|Caenorhabditis elegans cadmium-induc... 28 6.1 AF039050-3|AAC47936.2| 498|Caenorhabditis elegans Cytochrome p4... 28 8.1 >U58086-1|AAC47123.1| 803|Caenorhabditis elegans CUL-4 protein. Length = 803 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 KNLEFSVFYDKMRDEAIALFHLFYYAKDFETFYKTACFARVHLNQ 416 KN+ D+M DEAI LF FE +YK R+ L + Sbjct: 455 KNVSDDTTLDQMVDEAIVLFRYLRGKDVFEAYYKRGLAKRLFLER 499 >U29536-1|AAA68791.3| 840|Caenorhabditis elegans Cullin protein 4 protein. Length = 840 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 KNLEFSVFYDKMRDEAIALFHLFYYAKDFETFYKTACFARVHLNQ 416 KN+ D+M DEAI LF FE +YK R+ L + Sbjct: 492 KNVSDDTTLDQMVDEAIVLFRYLRGKDVFEAYYKRGLAKRLFLER 536 >U80848-1|AAB37990.3| 389|Caenorhabditis elegans Hypothetical protein T10H10.3 protein. Length = 389 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = -3 Query: 500 TSYGARNNETVAIRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLSVIE 348 TS+GARNN ++ R+ + + + +L H+ G++ + + LSVIE Sbjct: 126 TSFGARNNYVLSSRSFNRGALRYVPRKSLTASHS--IGNVEQGTRELSVIE 174 >Z75531-9|CAA99802.1| 277|Caenorhabditis elegans Hypothetical protein K01D12.12 protein. Length = 277 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/61 (22%), Positives = 29/61 (47%) Frame = -1 Query: 274 KPVLYILEILQQLSC*CSCPYSFRYHSLCQFYNIHHQCLVGSHLGRRTEFSFAFQQIRHP 95 K +Y+ + + +C P+ + LC+ YNI ++ +V S + R + F ++ Sbjct: 43 KDTVYLYQFKRLKNCPNLSPFCMKIEILCRVYNIPYE-IVESSMARSRNGTLPFIELNGE 101 Query: 94 H 92 H Sbjct: 102 H 102 >AY728060-1|AAU43721.1| 277|Caenorhabditis elegans cadmium-inducible lysosomal proteinCDR-6 protein. Length = 277 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/61 (22%), Positives = 29/61 (47%) Frame = -1 Query: 274 KPVLYILEILQQLSC*CSCPYSFRYHSLCQFYNIHHQCLVGSHLGRRTEFSFAFQQIRHP 95 K +Y+ + + +C P+ + LC+ YNI ++ +V S + R + F ++ Sbjct: 43 KDTVYLYQFKRLKNCPNLSPFCMKIEILCRVYNIPYE-IVESSMARSRNGTLPFIELNGE 101 Query: 94 H 92 H Sbjct: 102 H 102 >AF039050-3|AAC47936.2| 498|Caenorhabditis elegans Cytochrome p450 family protein 34A6 protein. Length = 498 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 133 SFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEF 252 +F +S ++TDDE +K K+++ E M+N +K + F Sbjct: 397 AFATQLSAMHTDDETFKNHKEFNPERFMENNNLEKKLIPF 436 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,857,226 Number of Sequences: 27780 Number of extensions: 313484 Number of successful extensions: 783 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 783 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -