BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0254.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyc... 27 3.4 SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccha... 27 3.4 SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo... 26 6.0 >SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 26.6 bits (56), Expect = 3.4 Identities = 14/56 (25%), Positives = 24/56 (42%) Frame = -2 Query: 412 ETXSSSHRVANVLXVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGASYP 245 + SS+ A + + + + PA S G+P+R A +SP +S P Sbjct: 139 QVPSSAASGARTQRTSITNDPQSSQSSSVSRNPASSRAGSPTRDNAPAASPASSEP 194 >SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = -3 Query: 270 PAHPGPHIRCADFFDAPQSRWNER*TGAVGFYPYSH*NYTSKNLS 136 P+ P + ++ FD+ + +N TG Y + +YT+ N S Sbjct: 314 PSTPSSAVTLSNGFDSQSNAYNNSGTGPPMLYKFPQRSYTAPNTS 358 >SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1045 Score = 25.8 bits (54), Expect = 6.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 152 QAKTFPLNISN*VQIQTPPHSVRDS 78 Q +FPL N Q + P HS+RD+ Sbjct: 501 QPHSFPLRKQNVAQSEFPKHSLRDN 525 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,620,596 Number of Sequences: 5004 Number of extensions: 51149 Number of successful extensions: 154 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -