BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0253.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1795.08c |||histone acetyltransferase complex subunit |Schiz... 27 3.4 SPAC8E11.01c ||SPAC959.01|beta-fructofuranosidase|Schizosaccharo... 26 6.0 SPBC18H10.11c |||conserved fungal protein|Schizosaccharomyces po... 26 6.0 >SPCC1795.08c |||histone acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 985 Score = 26.6 bits (56), Expect = 3.4 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -2 Query: 238 MRKMYASCALLGLPRMEHRSGPPSAASTAMRPPK*GPVDTS 116 +RK+ P M R+ PSAAST PP P++ S Sbjct: 834 IRKILKKREFAKKPTMTKRAIAPSAASTEKLPPVPSPLELS 874 >SPAC8E11.01c ||SPAC959.01|beta-fructofuranosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 508 Score = 25.8 bits (54), Expect = 6.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 177 PERCSIRGNPNSAQDAYILRI 239 PERC+ P+S +D YIL I Sbjct: 428 PERCTSSVPPSSYEDNYILEI 448 >SPBC18H10.11c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 432 Score = 25.8 bits (54), Expect = 6.0 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 4 RRTRPRRPAVDWIENHHCAHKRIFSPSYPVLTPRERSGKCRRDLILAVA 150 +RT PRR VD + N C R F+ +Y V R R+ L++A A Sbjct: 5 KRTFPRRAFVDLLLNRFCL--REFATTYSVSVSNARK-LVRKRLLIADA 50 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,673,405 Number of Sequences: 5004 Number of extensions: 49228 Number of successful extensions: 92 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -