BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0253.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 24 1.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 24 1.2 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 6.4 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 6.4 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 8.5 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 254 RSDVNETTVATYVIVQENLPILTHSTRRFL 343 +SD + T T + VQ NLPIL + F+ Sbjct: 103 KSDNEDITYPTVLEVQLNLPILKDGVQIFI 132 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 254 RSDVNETTVATYVIVQENLPILTHSTRRFL 343 +SD + T T + VQ NLPIL + F+ Sbjct: 141 KSDNEDITYPTVLEVQLNLPILKDGVQIFI 170 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 141 QNKVPSTLPTSLAWGKHWI 85 Q PSTL L+W W+ Sbjct: 205 QTFAPSTLVVMLSWFSFWL 223 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/43 (27%), Positives = 17/43 (39%) Frame = +1 Query: 178 QSGAPYEAIPTAHKTHTFYASITTSXVRRERDNRCYIRYRSRE 306 + G P + H Y T+ R D+R Y RY+ E Sbjct: 141 EPGTPRINFTKLKRHHPRYKRPRTTFEPRATDSRHYDRYKEEE 183 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = -2 Query: 301 LNDNVCSNG 275 ++DN+CSNG Sbjct: 369 IHDNICSNG 377 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,945 Number of Sequences: 438 Number of extensions: 3683 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -