BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0248.Seq (797 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55851| Best HMM Match : Hydrolase (HMM E-Value=0.95) 33 0.35 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 31 0.82 >SB_55851| Best HMM Match : Hydrolase (HMM E-Value=0.95) Length = 209 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +3 Query: 369 ADCXCFDVDSTVLQDXGIXXLGKXCG 446 AD CFDVDSTV+ I L CG Sbjct: 16 ADAVCFDVDSTVVTGEAIDELASFCG 41 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 31.5 bits (68), Expect = 0.82 Identities = 24/94 (25%), Positives = 38/94 (40%), Gaps = 2/94 (2%) Frame = -1 Query: 695 PXPEXQXSPGLTPLLSGXKLFPXKPGXYRGIXPKREIFPKEXPXNGPDVKPXMMPXXFXK 516 P P+ Q + ++P + P +P + P ++FP P P + P M+P Sbjct: 2571 PPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFP---PQMMPPMVPMMLPPMLPL 2627 Query: 515 PSRXV-IWPPXXFRRPVL-XPXSPFPAXLAQXXD 420 P + + P + P L P PFP A D Sbjct: 2628 PPPGLPMQPEAPVQPPPLPPPGGPFPPVAADQGD 2661 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,995,822 Number of Sequences: 59808 Number of extensions: 249789 Number of successful extensions: 328 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -