BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0248.Seq (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearl... 38 0.010 At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearl... 38 0.010 At1g26150.1 68414.m03192 protein kinase family protein similar t... 29 3.6 >At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 37.5 bits (83), Expect = 0.010 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +3 Query: 372 DCXCFDVDSTVLQDXGIXXLGKXCGEXRPGXKXWXAEAXG 491 + CFDVDSTV D GI L + CG + W A A G Sbjct: 84 EAVCFDVDSTVCVDEGIDELAEFCGAGK-AVAEWTARAMG 122 >At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 37.5 bits (83), Expect = 0.010 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +3 Query: 372 DCXCFDVDSTVLQDXGIXXLGKXCGEXRPGXKXWXAEAXG 491 + CFDVDSTV D GI L + CG + W A A G Sbjct: 84 EAVCFDVDSTVCVDEGIDELAEFCGAGK-AVAEWTARAMG 122 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 29.1 bits (62), Expect = 3.6 Identities = 25/89 (28%), Positives = 29/89 (32%), Gaps = 2/89 (2%) Frame = -1 Query: 710 DPPGXPXPEXQXSPGLTPLLSGXKLFPXKPGXYRGIXPKREIFP--KEXPXNGPDVKPXM 537 DPP P P + P P S + P P P+ P E P P Sbjct: 161 DPPSNPLPPPKLVP---PSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHP 217 Query: 536 MPXXFXKPSRXVIWPPXXFRRPVLXPXSP 450 P P R PP +RP P SP Sbjct: 218 SPPPPGHPKRREQPPPPGSKRPTPSPPSP 246 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,705,248 Number of Sequences: 28952 Number of extensions: 171415 Number of successful extensions: 253 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 253 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -