BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0245.Seq (797 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 27 3.1 SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 27 3.1 SPCC1393.11 |||mitochondrial ribosomal protein subunit L20|Schiz... 27 4.1 SPBC530.14c |dsk1||SR protein-specific kinase Dsk1|Schizosacchar... 26 5.4 SPAP27G11.15 |slx1||structure-specific endonuclease catalytic su... 26 5.4 SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|ch... 26 7.2 SPAC9G1.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 26 7.2 SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharo... 25 9.5 SPAC16E8.13 |||ubiquitin-protein ligase E3 |Schizosaccharomyces ... 25 9.5 >SPBC16C6.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 27.1 bits (57), Expect = 3.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 239 FFKDDETTIPNGQRSKSFQPNS 304 FFKD E + PN S+S P+S Sbjct: 273 FFKDTEMSTPNSNHSRSRTPSS 294 >SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 841 Score = 27.1 bits (57), Expect = 3.1 Identities = 17/65 (26%), Positives = 33/65 (50%) Frame = -1 Query: 548 SGNTCLSNH*SFITEGHNLQESESMTSANTMLPSVSTPNSIFMSISAQSRRAQAFSKISN 369 S N C SN +++ E E++ S T+ S + + + + + +AF +ISN Sbjct: 314 SQNDCFSNAMNYLEH-----EYETLVSTFTLSVSEHWEDLLRKATDSCQKELEAFEEISN 368 Query: 368 IRIVA 354 +R++A Sbjct: 369 LRVLA 373 >SPCC1393.11 |||mitochondrial ribosomal protein subunit L20|Schizosaccharomyces pombe|chr 3|||Manual Length = 197 Score = 26.6 bits (56), Expect = 4.1 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +1 Query: 181 KKKSWCTRRLQVHSSKTRDV--LQG*RNHDPQWSEEQIISAKFNYNGLLIGR 330 K KS R H + D+ +Q R DP +S KFN LLI R Sbjct: 97 KSKSKGKLRFSTHQLSSEDIKSIQDLRTKDPNAWTTGTLSKKFNTTRLLISR 148 >SPBC530.14c |dsk1||SR protein-specific kinase Dsk1|Schizosaccharomyces pombe|chr 2|||Manual Length = 544 Score = 26.2 bits (55), Expect = 5.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 474 DIRQYNATFCIDSEFYFHVNKCAVTQSPS 388 D++ N CID + H+ A T SP+ Sbjct: 214 DLKPENVLICIDQDALQHIEAPATTSSPT 242 >SPAP27G11.15 |slx1||structure-specific endonuclease catalytic subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 26.2 bits (55), Expect = 5.4 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 463 LADVIDSDSWRLWP 504 L ++DSD+WR WP Sbjct: 106 LKHLVDSDTWRRWP 119 >SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 487 Score = 25.8 bits (54), Expect = 7.2 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -1 Query: 497 NLQESESMTSANTMLPSVSTPNSIFMSISAQSRRAQAFSKI 375 ++QE+ SMT + +LPS S+ + QSRRA SK+ Sbjct: 128 HVQEAASMTQLSHLLPS-----SLINLSNGQSRRAMLASKL 163 >SPAC9G1.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 418 Score = 25.8 bits (54), Expect = 7.2 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 500 HNLQESESMTSANTMLPSVSTPNSIFMSISAQSRRA 393 HN SE+++++N+ +PS++ S M S A Sbjct: 17 HNAWGSENISNSNSAIPSITNDVSFSMEASVWKENA 52 >SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 615 LSPXAKVAVLTVSRSLQSPFVRFR*HLFVQPL 520 LSP + + + L++PFV F LFV P+ Sbjct: 347 LSPNLEQPHMLAASDLENPFVPFSSGLFVDPI 378 >SPAC16E8.13 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 547 Score = 25.4 bits (53), Expect = 9.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 178 ERASCKAAGNPFNGDHLTF 122 +R + K GN F GDH F Sbjct: 21 KRRASKVVGNSFGGDHFNF 39 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,039,992 Number of Sequences: 5004 Number of extensions: 61415 Number of successful extensions: 160 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 389395636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -