BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0245.Seq (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21110.1 68416.m02668 phosphoribosylamidoimidazole-succinocar... 35 0.072 At5g53060.1 68418.m06592 KH domain-containing protein 28 8.3 >At3g21110.1 68416.m02668 phosphoribosylamidoimidazole-succinocarboxamide synthase / SAICAR synthetase (PUR7) identical to phosphoribosylamidoimidazole-succinocarboxamide synthase, chloroplast [precursor] SP:P38025 from [Arabidopsis thaliana] Length = 411 Score = 34.7 bits (76), Expect = 0.072 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 1/83 (1%) Frame = +1 Query: 256 NHDPQWSEEQIISAKFNYNGLLIGRDEVDYMRKATILIFEILEKAWALRDCALIDMKIEF 435 +HD S +I+ F + + E D + +FE + L+D K EF Sbjct: 242 DHDVPISPNEIVEGGF------MTQAEFDEASMKALSLFEFGQGVAKKHGLILVDTKYEF 295 Query: 436 GVDTEGSIVLADVIDS-DSWRLW 501 G ++GSI+L D I + DS R W Sbjct: 296 GRSSDGSILLIDEIHTPDSSRYW 318 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 80 AFVKIASETAFLSKKCEMIPIEWVTRRLATGS 175 A V ++KKC + PIE+V R TGS Sbjct: 167 AIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGS 198 >At5g53060.1 68418.m06592 KH domain-containing protein Length = 652 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 699 GFGEPPLKXXQTXGGXNPSGXXRKSRLVLS 610 G+G PP + + GG P G +RLV+S Sbjct: 154 GYGGPPPEEEEDYGGVRPGGGRVVTRLVVS 183 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,518,862 Number of Sequences: 28952 Number of extensions: 346194 Number of successful extensions: 660 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 639 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -