BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0244.Seq (797 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32780| Best HMM Match : SAICAR_synt (HMM E-Value=0) 75 7e-14 SB_21014| Best HMM Match : SAICAR_synt (HMM E-Value=2.2e-28) 75 7e-14 >SB_32780| Best HMM Match : SAICAR_synt (HMM E-Value=0) Length = 278 Score = 74.9 bits (176), Expect = 7e-14 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = +3 Query: 255 DPQWSEEQIISAKFNYNGLLIGRDEVDYMRKATILIFEILEKAWALRDCALIDMKIEFGV 434 DP W+ EQ + A F G IG+ E+D M ++ I IFEI+E+AWA D AL+DMKIEFGV Sbjct: 135 DPFWTYEQCVEAAFEIGGRKIGKHELDIMSESAIAIFEIIERAWATVDVALVDMKIEFGV 194 Query: 435 DTE-GSIVL 458 + + G ++L Sbjct: 195 NRKTGELML 203 >SB_21014| Best HMM Match : SAICAR_synt (HMM E-Value=2.2e-28) Length = 265 Score = 74.9 bits (176), Expect = 7e-14 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = +3 Query: 255 DPQWSEEQIISAKFNYNGLLIGRDEVDYMRKATILIFEILEKAWALRDCALIDMKIEFGV 434 DP W+ EQ + A F G IG+ E+D M ++ I IFEI+E+AWA D AL+DMKIEFGV Sbjct: 45 DPFWTYEQCVEAAFEIGGRKIGKHELDIMSESAIAIFEIIERAWATVDVALVDMKIEFGV 104 Query: 435 DTE-GSIVL 458 + + G ++L Sbjct: 105 NRKTGELML 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,954,877 Number of Sequences: 59808 Number of extensions: 274631 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -