BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0242.Seq (797 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal prot... 130 1e-30 Z74041-9|CAA98523.2| 801|Caenorhabditis elegans Hypothetical pr... 30 1.7 Z74035-5|CAA98485.2| 801|Caenorhabditis elegans Hypothetical pr... 30 1.7 >U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal protein, small subunitprotein 2 protein. Length = 272 Score = 130 bits (313), Expect = 1e-30 Identities = 60/71 (84%), Positives = 66/71 (92%) Frame = +1 Query: 268 SLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKL 447 +L DEVLKI PVQKQT AGQRTRFKAFVAIGD+ GH+GLGVKCSKEVATAIRGAI+ AKL Sbjct: 97 NLKDEVLKISPVQKQTTAGQRTRFKAFVAIGDHAGHVGLGVKCSKEVATAIRGAIVAAKL 156 Query: 448 SVLPVRRGYWG 480 +V+PVRRGYWG Sbjct: 157 AVVPVRRGYWG 167 Score = 65.7 bits (153), Expect = 4e-11 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +2 Query: 131 EDQKEWVPVTKLGRLVREGKIDKLESIYLFSLPIKEFEIIDS 256 E + EW PVTKLGRLV+E KI LE IYL SLPIKEFEIID+ Sbjct: 52 EKETEWTPVTKLGRLVKEKKITTLEEIYLNSLPIKEFEIIDA 93 >Z74041-9|CAA98523.2| 801|Caenorhabditis elegans Hypothetical protein F47G9.3 protein. Length = 801 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 351 NKCLETCALSGTCLFLYR-HDLKNLIIQGRAEEESMISNSLIGKEN 217 ++CLE C +S C F Y+ D+ N +I R M++ + N Sbjct: 286 SECLEKCTMSEECRFAYQSKDMNNCLISRRRMALPMLAQKICADVN 331 >Z74035-5|CAA98485.2| 801|Caenorhabditis elegans Hypothetical protein F47G9.3 protein. Length = 801 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 351 NKCLETCALSGTCLFLYR-HDLKNLIIQGRAEEESMISNSLIGKEN 217 ++CLE C +S C F Y+ D+ N +I R M++ + N Sbjct: 286 SECLEKCTMSEECRFAYQSKDMNNCLISRRRMALPMLAQKICADVN 331 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,077,070 Number of Sequences: 27780 Number of extensions: 303588 Number of successful extensions: 655 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -