BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0239.Seq (758 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7KPI8 Cluster: Aminopeptidase-1; n=3; Caenorhabditis e... 37 0.47 UniRef50_A5E672 Cluster: Putative uncharacterized protein; n=1; ... 34 4.4 >UniRef50_Q7KPI8 Cluster: Aminopeptidase-1; n=3; Caenorhabditis elegans|Rep: Aminopeptidase-1 - Caenorhabditis elegans Length = 609 Score = 37.1 bits (82), Expect = 0.47 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = -1 Query: 191 IKDVNSTNTSDNQLIKLVSRLAEADRDTATSSIPYHTMTGAL*TIPQKI 45 ++ VN D++ KLV L AD D A SS+PY + L TI Q + Sbjct: 353 VRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQAL 401 >UniRef50_A5E672 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 353 Score = 33.9 bits (74), Expect = 4.4 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +2 Query: 413 LYYFVFPKVVSKTPPLFYVQCGYRYMYRVLMGY*SVNH-ISWRMFNGNTEXPESSPGEPR 589 L Y +VS P Y++ YRY L+ Y ++ H W +FN E P + + Sbjct: 30 LSYITPQLIVSSAPTTTYIESWYRYPLGDLLKYLNLKHPHHWWLFNFRGEEPGYLDEDVQ 89 Query: 590 NKIGTFP 610 K+ +P Sbjct: 90 GKVNHYP 96 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 750,618,790 Number of Sequences: 1657284 Number of extensions: 15536509 Number of successful extensions: 31565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31554 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62969581935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -