BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0239.Seq (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 26 1.5 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 3.3 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.8 bits (54), Expect = 1.5 Identities = 18/81 (22%), Positives = 37/81 (45%) Frame = -1 Query: 392 KCNEHWYQNIHSNILNGVRVHVTLDMCTKILEYFA*DVITITPD*SDTKIILRRRLKNIS 213 K +++ + L+G+ LD+ + L D+ P S +I L+ ++ Sbjct: 275 KIHDNEISMVGDKALSGLNELQILDLSSNKLVALPTDLFR-DPAQSIQEIYLQNNSISVL 333 Query: 212 PPGMFKNIKDVNSTNTSDNQL 150 PG+F ++ + + + S NQL Sbjct: 334 SPGLFSKLEQLQALDLSQNQL 354 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -1 Query: 248 KIILRRRLKNISPPGMFKNIKDVNSTNTSDNQL 150 +I L+ N+ PG+F ++K + + S+N+L Sbjct: 286 EIYLQNNSLNVLAPGIFSDLKQLLVLDLSNNEL 318 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 801,808 Number of Sequences: 2352 Number of extensions: 17167 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -