BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0237.Seq (578 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 27 0.44 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 25 2.3 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 24 3.1 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 24 3.1 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 24 3.1 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 5.4 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 7.2 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 7.2 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 7.2 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 7.2 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 27.1 bits (57), Expect = 0.44 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = -3 Query: 201 LKSEGTLLYSCDIGLLKLPHR-HIVLCR--CSQTC*ERDIVHLHNIG 70 LK G + C G K+P V C+ C +TC IVH NIG Sbjct: 270 LKDNGACVRKCPKG--KMPQNSECVPCKGVCPKTCPGEGIVHSDNIG 314 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 24.6 bits (51), Expect = 2.3 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 239 TSNIRP-RTNAIPTSVAYSHTQRPEIFCPAHTMSSAITK 352 TS + P T PT TQ P P HT +S T+ Sbjct: 417 TSTVAPGTTTTTPTGANPGTTQPPTSDAPNHTTTSTTTE 455 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 24.2 bits (50), Expect = 3.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 231 HWCCLGCRIQLKS 193 HW C+GC LK+ Sbjct: 61 HWSCIGCTNMLKN 73 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 24.2 bits (50), Expect = 3.1 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +2 Query: 209 RHPKQHQCCQTSNIRPRTNAIPTSVAYSHTQRP 307 R + QCCQ + I P A S + T P Sbjct: 34 RREEMEQCCQVNMIIPLDGAEDCSSSVDETSEP 66 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 24.2 bits (50), Expect = 3.1 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +2 Query: 209 RHPKQHQCCQTSNIRPRTNAIPTSVAYSHTQRP 307 R + QCCQ + I P A S + T P Sbjct: 34 RREEMEQCCQVNMIIPLDGAEDCSSSVDETSEP 66 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 5.4 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +1 Query: 325 SHYEFSHHQTSNLYCSSNSYR 387 S+Y SH+Q+S+ SS+S++ Sbjct: 108 SYYSSSHYQSSSSSSSSSSFQ 128 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 171 RSTRESLPTSAESDTPNNTN 230 R R+SLP ++ +++ NN N Sbjct: 186 RDERDSLPNASSNNSNNNNN 205 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 171 RSTRESLPTSAESDTPNNTN 230 R R+SLP ++ +++ NN N Sbjct: 186 RDERDSLPNASSNNSNNNNN 205 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 171 RSTRESLPTSAESDTPNNTN 230 R R+SLP ++ +++ NN N Sbjct: 138 RDERDSLPNASSNNSNNNNN 157 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 171 RSTRESLPTSAESDTPNNTN 230 R R+SLP ++ +++ NN N Sbjct: 186 RDERDSLPNASSNNSNNNNN 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,875 Number of Sequences: 2352 Number of extensions: 12533 Number of successful extensions: 41 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -