BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0235.Seq (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 1.8 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 7.3 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 181 AVLRSSVCLGQLSSEMAYKTASFFKRFDSLPVP 279 A L+SS C LSS + SF D P+P Sbjct: 26 ATLQSSACTDDLSSCWSEDMGSFSLPLDLEPLP 58 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +1 Query: 430 SRPMENSRGEGRWAPKK 480 S+P++ + G+W P+K Sbjct: 424 SKPVQTTPKPGQWVPEK 440 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,446 Number of Sequences: 336 Number of extensions: 3279 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -