BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0233.Seq (797 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57289| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.037) 29 3.3 SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22) 29 3.3 SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_50155| Best HMM Match : SPRY (HMM E-Value=7.7e-14) 28 7.6 SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) 28 7.6 >SB_57289| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.037) Length = 396 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/79 (21%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +2 Query: 251 HKISSSIAINVTDLRHRLGGIQNQLNEATRHCQDI-SYLENISKPSSNVTELKQVPSSSK 427 HK ++S+ +N+T+LR +L ++++ + +D+ + ++ N Q P K Sbjct: 243 HKQNTSLELNITELRLKLKATDKEMHQERQKVRDVEAVVKRFKTDLYNCVGFIQEPKKLK 302 Query: 428 HQIEQSVQGQYNESEVKYS 484 ++ Q +Y + E S Sbjct: 303 ENVKALYQ-KYVQDETPES 320 >SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22) Length = 874 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/79 (21%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +2 Query: 251 HKISSSIAINVTDLRHRLGGIQNQLNEATRHCQDI-SYLENISKPSSNVTELKQVPSSSK 427 HK ++S+ +N+T+LR +L ++++ + +D+ + ++ N Q P K Sbjct: 689 HKQNTSLELNITELRLKLKATDKEMHQERQKVRDVEAVVKRFKTDLYNCVGFIQEPKKLK 748 Query: 428 HQIEQSVQGQYNESEVKYS 484 ++ Q +Y + E S Sbjct: 749 ENVKALYQ-KYVQDETPES 766 >SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2671 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = +2 Query: 347 QDISYLENISKPSSNVTELKQVPSSSKHQIEQSVQGQYNESEVKYSTKHRG 499 + +S +S+PS ++ + SS +E+++ + N+ + K S +H G Sbjct: 1598 KSVSKHGKLSEPSDGMSSSSRSTCSSSADLEKAISNKENDKQYKSSGRHEG 1648 >SB_50155| Best HMM Match : SPRY (HMM E-Value=7.7e-14) Length = 453 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -2 Query: 337 GRFIQLILDATQSMSQVGDV-DRDTGAYLMDGCDEVPNARRKK 212 GR+ LI A+ +++V + +R Y++D + PNARR+K Sbjct: 203 GRWDALIKQASDILNKVLKIAERKNRNYILDQTNVYPNARRRK 245 >SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) Length = 2024 Score = 28.3 bits (60), Expect = 7.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 264 ELILWMVVMKYPMHVERNSL*RGTCAWY 181 E +W V +HVE +L G C WY Sbjct: 1921 ECCVWKCVFVLVLHVEVRALADGACGWY 1948 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,876,187 Number of Sequences: 59808 Number of extensions: 656152 Number of successful extensions: 2071 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2058 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -