BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0231.Seq (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 22 6.0 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 22 6.0 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 6.0 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 100 HHFQNTFKLIQTTYVK 53 +H QN FK+I++T K Sbjct: 57 NHIQNIFKIIKSTNEK 72 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 100 HHFQNTFKLIQTTYVK 53 +H QN FK+I++T K Sbjct: 40 NHIQNIFKIIKSTNEK 55 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = -3 Query: 233 DLN*SETLNKHLVAYFQYPLINNVTNLCLRRNYLEIVKDYLSLQAS 96 D+N ET+ + L Y+Q ++ V L ++++ KD + + + Sbjct: 508 DMN-YETMGRALRYYYQRGILAKVDGQRLVYQFVDVPKDIIEIDCT 552 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,528 Number of Sequences: 438 Number of extensions: 3100 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -