BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0229.Seq (648 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY596776-1|AAT02353.1| 127|Homo sapiens HCV p7-transactivated p... 31 4.7 AK124507-1|BAC85868.1| 127|Homo sapiens protein ( Homo sapiens ... 31 4.7 >AY596776-1|AAT02353.1| 127|Homo sapiens HCV p7-transactivated protein 1 protein. Length = 127 Score = 30.7 bits (66), Expect = 4.7 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -1 Query: 390 RARAGTASSGTPSCGSSRNARWCCLSPSQILFNTVSS 280 R R G + TP CGS+R+A WC PS+ +T SS Sbjct: 91 RCRCGACALWTP-CGSARSAPWC---PSRRRSSTTSS 123 >AK124507-1|BAC85868.1| 127|Homo sapiens protein ( Homo sapiens cDNA FLJ42516 fis, clone BRACE2047385. ). Length = 127 Score = 30.7 bits (66), Expect = 4.7 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -1 Query: 390 RARAGTASSGTPSCGSSRNARWCCLSPSQILFNTVSS 280 R R G + TP CGS+R+A WC PS+ +T SS Sbjct: 91 RCRCGACALWTP-CGSARSAPWC---PSRRRSSTTSS 123 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,192,956 Number of Sequences: 237096 Number of extensions: 1164662 Number of successful extensions: 2117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2117 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7197658880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -