BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0228.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC18H10.05 |||WD repeat protein Wdr44 family, WD repeat protei... 28 1.5 SPAC922.03 |||1-aminocyclopropane-1-carboxylate deaminase |Schiz... 28 1.5 SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s... 26 4.5 >SPBC18H10.05 |||WD repeat protein Wdr44 family, WD repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 586 Score = 27.9 bits (59), Expect = 1.5 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 5/64 (7%) Frame = +2 Query: 503 IRDGYIVSGA---KVNLWAFLTLA*WHWVLQCVLHGLLCQTYNGSSPIYXVICGL--VWE 667 I D Y VSG+ K+ LW+ L HW + +C +G S + + GL ++E Sbjct: 306 IDDRYFVSGSLDCKIQLWSILRHKILHWTELEYVVSTICFYPDGESIVVGMFYGLCAIYE 365 Query: 668 IRGL 679 + L Sbjct: 366 TKNL 369 >SPAC922.03 |||1-aminocyclopropane-1-carboxylate deaminase |Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 27.9 bits (59), Expect = 1.5 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +3 Query: 108 VGNLSLSEIYTSXXXXXXXXXXXXXEXXFKTILKAMHHAGKEPFP 242 VGN+ LS I + FK L+ + GK+PFP Sbjct: 113 VGNIELSRIVNADVRLDSSKFDIGIRPSFKNALEELTKKGKKPFP 157 >SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 26.2 bits (55), Expect = 4.5 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 410 KKILLQEDPSLPKATVVKICETTEHR 487 +KILL E P P A K+CET R Sbjct: 101 RKILLTEPPMNPVANREKMCETMFER 126 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,760,501 Number of Sequences: 5004 Number of extensions: 53644 Number of successful extensions: 191 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -