BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0225.Seq (648 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB209372-1|BAD92609.1| 648|Homo sapiens mitogen-activated prote... 31 4.7 BC110451-1|AAI10452.1| 1042|Homo sapiens corin, serine peptidase... 30 6.2 AF133845-1|AAD31850.1| 1042|Homo sapiens corin protein. 30 6.2 >AB209372-1|BAD92609.1| 648|Homo sapiens mitogen-activated protein kinase kinase kinase 7 interacting protein 1 isoform protein. Length = 648 Score = 30.7 bits (66), Expect = 4.7 Identities = 26/77 (33%), Positives = 31/77 (40%) Frame = -2 Query: 542 ASDHLDLNSESFLRCFVEYFXSLSLYCPCTLCSI*CFEDEGTCLSSVTLLEGFEIFSK*L 363 AS L L L C + SL Y C S+ + G L +V L GF IFS Sbjct: 32 ASSPLHLAGFPLLACIFSWLPSLFPYPLCL--SLWGWGSMGDALLNVPLFLGFPIFSPLT 89 Query: 362 ISWQCLVASFN*FWMPP 312 +S C A W PP Sbjct: 90 LSPMCGTAYSARSWDPP 106 >BC110451-1|AAI10452.1| 1042|Homo sapiens corin, serine peptidase protein. Length = 1042 Score = 30.3 bits (65), Expect = 6.2 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -2 Query: 614 CAMFCYLHATLQCNGYCHHDPDFWASDHLDLN-SESFLRCFVEYFXSLSLYC 462 CA + LQCNGY +D D W SD N SE+ C + SL C Sbjct: 277 CASGICIPGKLQCNGY--NDCDDW-SDEAHCNCSENLFHCHTGKCLNYSLVC 325 >AF133845-1|AAD31850.1| 1042|Homo sapiens corin protein. Length = 1042 Score = 30.3 bits (65), Expect = 6.2 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -2 Query: 614 CAMFCYLHATLQCNGYCHHDPDFWASDHLDLN-SESFLRCFVEYFXSLSLYC 462 CA + LQCNGY +D D W SD N SE+ C + SL C Sbjct: 277 CASGICIPGKLQCNGY--NDCDDW-SDEAHCNCSENLFHCHTGKCLNYSLVC 325 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,145,860 Number of Sequences: 237096 Number of extensions: 1788917 Number of successful extensions: 7315 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7315 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7197658880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -