BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0223.Seq (801 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_7419| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_35330| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48816| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 48 1e-05 SB_55488| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_54991| Best HMM Match : Beta-lactamase (HMM E-Value=7.8) 48 1e-05 SB_50511| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) 48 1e-05 SB_50349| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) 48 1e-05 SB_47079| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) 48 1e-05 SB_42277| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) 48 1e-05 SB_40847| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) 48 1e-05 SB_39129| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) 48 1e-05 SB_38007| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_34630| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_33683| Best HMM Match : Beta-lactamase (HMM E-Value=0.00036) 48 1e-05 SB_33025| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_29432| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_29208| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_26508| Best HMM Match : Beta-lactamase (HMM E-Value=1.7e-22) 48 1e-05 SB_25861| Best HMM Match : Beta-lactamase (HMM E-Value=3e-15) 48 1e-05 SB_22916| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) 48 1e-05 SB_18350| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) 48 1e-05 SB_15754| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_9215| Best HMM Match : Beta-lactamase (HMM E-Value=3.9e-22) 48 1e-05 SB_5669| Best HMM Match : Beta-lactamase (HMM E-Value=1.6e-07) 48 1e-05 SB_2397| Best HMM Match : Beta-lactamase (HMM E-Value=4.5e-21) 48 1e-05 SB_1907| Best HMM Match : Beta-lactamase (HMM E-Value=6e-06) 48 1e-05 SB_1602| Best HMM Match : Beta-lactamase (HMM E-Value=2.4e-22) 48 1e-05 SB_1409| Best HMM Match : Beta-lactamase (HMM E-Value=1.8e-12) 48 1e-05 SB_1132| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_57475| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 47 2e-05 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 46 3e-05 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 46 3e-05 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 46 3e-05 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 46 3e-05 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 46 3e-05 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 46 3e-05 SB_33629| Best HMM Match : Extensin_2 (HMM E-Value=2.2) 46 3e-05 SB_33453| Best HMM Match : BRF1 (HMM E-Value=1.4) 46 3e-05 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_30748| Best HMM Match : RBM1CTR (HMM E-Value=2.1) 46 3e-05 SB_22086| Best HMM Match : Ion_trans_2 (HMM E-Value=0.00052) 46 3e-05 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 46 3e-05 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 46 3e-05 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) 46 4e-05 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) 46 5e-05 SB_24550| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) 45 6e-05 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 45 8e-05 SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96) 45 8e-05 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 44 1e-04 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 44 1e-04 SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) 44 1e-04 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 44 1e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 44 1e-04 SB_48803| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 44 1e-04 SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6302| Best HMM Match : DUF594 (HMM E-Value=4.4) 44 2e-04 SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) 44 2e-04 SB_50117| Best HMM Match : EB1 (HMM E-Value=3.6) 44 2e-04 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 43 3e-04 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 43 3e-04 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 43 3e-04 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 43 3e-04 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 43 3e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 43 3e-04 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 43 3e-04 SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 43 3e-04 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 43 3e-04 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 43 3e-04 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 3e-04 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 43 3e-04 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 43 3e-04 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 43 3e-04 SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) 43 3e-04 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 43 3e-04 SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) 43 3e-04 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 43 3e-04 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 43 3e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 43 3e-04 SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48921| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48840| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48531| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48210| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 43 3e-04 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 43 3e-04 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47936| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47873| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47842| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47650| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47060| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46943| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46899| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 43 3e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46559| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 43 3e-04 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46255| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46237| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45828| Best HMM Match : S-antigen (HMM E-Value=0.0095) 43 3e-04 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45770| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45428| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45376| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45360| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44882| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 43 3e-04 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 43 3e-04 SB_44716| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44551| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44121| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 43 3e-04 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43812| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 43 3e-04 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 43 3e-04 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43415| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43235| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43116| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 43 3e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 43 3e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42148| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 43 3e-04 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41597| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41534| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41390| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40755| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40748| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40671| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40647| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40555| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40354| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39915| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39901| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39749| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39688| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39619| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39535| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39117| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 43 3e-04 SB_39027| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38970| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 43 3e-04 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 43 3e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38472| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38131| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38069| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38008| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37882| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37739| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37640| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37631| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37441| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37409| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37176| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37098| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36766| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36634| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36591| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36255| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36142| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36100| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35967| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35870| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35723| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35236| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35015| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34995| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34882| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34723| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 43 3e-04 SB_34164| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34076| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33847| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33842| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33832| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33796| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 43 3e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33225| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32681| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 43 3e-04 SB_32505| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 >SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQR 362 DAPCSGALSAAGVVVTRSV+RYTCQR Sbjct: 111 DAPCSGALSAAGVVVTRSVTRYTCQR 136 >SB_7419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQR 362 DAPCSGALSAAGVVVTRSV RYTCQR Sbjct: 31 DAPCSGALSAAGVVVTRSVDRYTCQR 56 >SB_35330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQR 362 DAPCSGALSAAGV VTRSV+RYTCQR Sbjct: 31 DAPCSGALSAAGVEVTRSVNRYTCQR 56 >SB_48816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQR 362 DAPCSGALSAAGVVVT RYTCQR Sbjct: 81 DAPCSGALSAAGVVVTAQRDRYTCQR 106 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/45 (55%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRR 308 DAPCSGALSAAGVVVTRSV+ R F R+ P +H+ R Sbjct: 94 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPQQQHIHR 138 >SB_55488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_54991| Best HMM Match : Beta-lactamase (HMM E-Value=7.8) Length = 121 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_50511| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) Length = 211 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_50349| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) Length = 211 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_47079| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) Length = 211 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_42277| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) Length = 211 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_40847| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) Length = 211 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_39129| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) Length = 211 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_38007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_34630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_33683| Best HMM Match : Beta-lactamase (HMM E-Value=0.00036) Length = 143 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_33025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_29432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_29208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_26508| Best HMM Match : Beta-lactamase (HMM E-Value=1.7e-22) Length = 202 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_25861| Best HMM Match : Beta-lactamase (HMM E-Value=3e-15) Length = 188 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_22916| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) Length = 211 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_18350| Best HMM Match : Beta-lactamase (HMM E-Value=3.8e-26) Length = 211 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_15754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_9215| Best HMM Match : Beta-lactamase (HMM E-Value=3.9e-22) Length = 202 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_5669| Best HMM Match : Beta-lactamase (HMM E-Value=1.6e-07) Length = 166 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_2397| Best HMM Match : Beta-lactamase (HMM E-Value=4.5e-21) Length = 205 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_1907| Best HMM Match : Beta-lactamase (HMM E-Value=6e-06) Length = 156 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_1602| Best HMM Match : Beta-lactamase (HMM E-Value=2.4e-22) Length = 202 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_1409| Best HMM Match : Beta-lactamase (HMM E-Value=1.8e-12) Length = 187 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_1132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/51 (54%), Positives = 31/51 (60%) Frame = +2 Query: 647 TLVKVKDAQDQLGARVGYIRTGSQQR*DP*EFSPPKNVFNDEALFKVLLCG 799 TLVKVKDA+DQLGARVGYI F P + F + FKVLLCG Sbjct: 2 TLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-FPMMSTFKVLLCG 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 705 ELDLNSGKILESFRPRRTFSMMRHF 779 ELDLNSGKILESFRP F MM F Sbjct: 21 ELDLNSGKILESFRPEERFPMMSTF 45 >SB_57475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQR 362 DAPCSGALSAAGVVV RYTCQR Sbjct: 31 DAPCSGALSAAGVVVNAQRDRYTCQR 56 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQR 362 DAPCSGALSAAGVVV RYTCQR Sbjct: 665 DAPCSGALSAAGVVVNAQRDRYTCQR 690 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 171 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 225 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 178 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 232 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 405 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 459 >SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) Length = 372 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 123 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 177 >SB_32525| Best HMM Match : DED (HMM E-Value=0.81) Length = 372 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 91 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 145 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 168 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 222 >SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) Length = 889 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 187 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 241 >SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 165 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 219 >SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) Length = 458 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 183 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 237 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 825 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 879 >SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 130 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 184 >SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 340 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 394 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 77 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 131 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 337 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 391 >SB_33629| Best HMM Match : Extensin_2 (HMM E-Value=2.2) Length = 958 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 60 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 114 >SB_33453| Best HMM Match : BRF1 (HMM E-Value=1.4) Length = 412 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 135 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 101 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 155 >SB_30748| Best HMM Match : RBM1CTR (HMM E-Value=2.1) Length = 390 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 180 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 234 >SB_22086| Best HMM Match : Ion_trans_2 (HMM E-Value=0.00052) Length = 458 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 171 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 225 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 93 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 147 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 600 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 654 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 743 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 779 >SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) Length = 716 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 352 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 406 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +L + + +GAP Sbjct: 676 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAEQEGQLIETEA-TGAP 730 >SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) Length = 425 Score = 46.0 bits (104), Expect = 4e-05 Identities = 32/62 (51%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFL--SRHVRRLSPSSSKSGAPFR 269 DAPCSGALSAAGVVVTRSV+ R F R+ P L S V R+ P S A Sbjct: 199 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLPSSSSVLRVIPFFSLFRAILS 258 Query: 268 VP 263 VP Sbjct: 259 VP 260 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRH 317 DAPCSGALSAAGVVVTRSV+ R F R+ P RH Sbjct: 336 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPQRRH 377 >SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1153 Score = 45.6 bits (103), Expect = 5e-05 Identities = 27/53 (50%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKS 284 DAPCSGALSAAGVVVTRSV+ R F R+ P LS + P S ++ Sbjct: 449 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLSLEYQYRIPVSLRT 501 >SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) Length = 471 Score = 45.6 bits (103), Expect = 5e-05 Identities = 26/51 (50%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSS 290 DAPCSGALSAAGVVVTRSV+ R F R+ P L V + +S+ Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLEARVAKCVSASA 131 >SB_24550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 45.2 bits (102), Expect = 6e-05 Identities = 24/37 (64%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ RSF R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRSFCRYAP 67 >SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 45.2 bits (102), Expect = 6e-05 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLS 302 DAPCSGALSAAGVVVTRSV+ R F R+ P SR LS Sbjct: 403 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPPSRLFAELS 449 >SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) Length = 670 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/47 (55%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLS 302 DAPCSGALSAAGVVVTRSV+ R F R+ P S + R+S Sbjct: 312 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPQSFYNNRMS 358 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 44.8 bits (101), Expect = 8e-05 Identities = 24/49 (48%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPS 296 DAPCSGALSAAGVVVTRSV+ R F R+ P +++ P+ Sbjct: 161 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPQMKYISLFPPT 209 >SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96) Length = 244 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/51 (50%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSS 290 DAPCSGALSAAGVVVTRSV+ R F R+ P RL +S+ Sbjct: 126 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPRQETFERLKMTSN 176 >SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) Length = 475 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/45 (55%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRR 308 DAPCSGALSAAGVVVTRSV+ R F R+ P L +R+ Sbjct: 267 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLHSLLRK 311 >SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1636 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLS 302 DAPCSGALSAAGVVVTRSV+ R F R+ P +V LS Sbjct: 491 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPRRFYVTHLS 537 >SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) Length = 711 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/41 (58%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSR 320 DAPCSGALSAAGVVVTRSV+ R F R+ P L++ Sbjct: 260 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLAK 300 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 44.4 bits (100), Expect = 1e-04 Identities = 29/65 (44%), Positives = 35/65 (53%), Gaps = 5/65 (7%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP----FLSRHVRRLSPSSSKSGAP 275 DAPCSGALSAAGVVVTRSV+ R F R+ P + V + S + AP Sbjct: 621 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPRKEGEDQDVESKADSGESTTAP 680 Query: 274 FRVPI 260 VP+ Sbjct: 681 QEVPV 685 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/44 (54%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVR 311 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ ++ Sbjct: 299 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLASLIK 342 >SB_48803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 44.0 bits (99), Expect = 1e-04 Identities = 28/55 (50%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGA 278 DAPCSGALSAAGVVVTRSV+ R F R+ P + + PS KS A Sbjct: 60 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP--PQRGTKSVPSLPKSNA 112 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/52 (51%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFL-SRHVRRLSPSSS 290 DAPCSGALSAAGVVVTRSV+ R F R+ P L +R + +SS Sbjct: 2507 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLANREISHAVDTSS 2558 >SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) Length = 519 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRR 308 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ +RR Sbjct: 366 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLT-SIRR 409 >SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 44.0 bits (99), Expect = 1e-04 Identities = 31/64 (48%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSG---APF 272 DAPCSGALSAAGVVVTRSV+ R F R+ P V R S G P Sbjct: 106 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPRGDGVIRCKSVLSMLGVDVGPP 165 Query: 271 RVPI 260 R+PI Sbjct: 166 RLPI 169 >SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 44.0 bits (99), Expect = 1e-04 Identities = 31/73 (42%), Positives = 39/73 (53%), Gaps = 3/73 (4%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSS--KSGAPFR 269 DAPCSGALSAAGVVVTRSV+ R F R+ P + +++ P+ G F Sbjct: 98 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPRNTQ-KKVGPAQKALTKGLFFP 156 Query: 268 VPI*CLRHLDPKK 230 I CL +L K Sbjct: 157 RVIGCLEYLRSMK 169 >SB_6302| Best HMM Match : DUF594 (HMM E-Value=4.4) Length = 339 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/59 (45%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLSRHVRRLSPSSSKSGAPFRV 266 DAPCSGALSAAGVVVTRSV+ R F R+ P R V ++ S P + Sbjct: 264 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPQVRAVVMVAVKSDTITKPTNI 322 >SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) Length = 696 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLS 323 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ Sbjct: 308 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLN 347 >SB_50117| Best HMM Match : EB1 (HMM E-Value=3.6) Length = 362 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLS 323 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ Sbjct: 144 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLT 183 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLPFLS 323 DAPCSGALSAAGVVVTRSV+ R F R+ P L+ Sbjct: 141 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAPPLN 180 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 87 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 123 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 96 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 132 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 88 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 124 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 114 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 150 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 94 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 130 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 119 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 155 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 90 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 126 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 110 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 146 >SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 122 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 158 >SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 60 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 96 >SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 98 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 134 >SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 87 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 123 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 102 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 138 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 111 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 147 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 105 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 141 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 121 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 157 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 109 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 145 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 92 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 128 >SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 163 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 199 >SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 99 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 135 >SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 433 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 469 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 159 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 195 >SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 135 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 171 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 91 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 127 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 60 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 96 >SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 90 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 126 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 155 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 191 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 97 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 133 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 392 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 428 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 132 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 168 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 102 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 138 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 111 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 147 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 95 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 131 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 186 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 222 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 115 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 151 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 91 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 127 >SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 195 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 231 >SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 112 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 148 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 86 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 122 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 125 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 161 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 87 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 123 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 119 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 155 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 108 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 144 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 121 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 157 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 117 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 153 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 102 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 138 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 88 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 124 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 89 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 125 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 153 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 189 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 166 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 202 >SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 110 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 146 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 89 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 125 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 86 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 122 >SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 448 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 484 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 97 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 133 >SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 106 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 142 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 88 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 124 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 107 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 143 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 117 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 153 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 120 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 156 >SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 466 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 502 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 119 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 155 >SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 89 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 125 >SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 108 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 144 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 98 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 134 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 101 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 137 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 213 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 249 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 117 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 153 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 104 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 140 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 106 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 142 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 115 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 151 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) Length = 129 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 90 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 126 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 237 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 273 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 86 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 122 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 92 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 128 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 106 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 142 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 103 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 139 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) Length = 146 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 108 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 144 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 86 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 122 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 87 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 123 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 101 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 137 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 91 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 127 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 93 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 129 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 136 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 172 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 392 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 428 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 142 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 178 >SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) Length = 93 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 55 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 91 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 138 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 174 >SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 88 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 124 >SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 346 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 382 >SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 109 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 145 >SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) Length = 119 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 80 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 116 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 110 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 146 >SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 88 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 124 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 463 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 499 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 147 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 183 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 103 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 139 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 95 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 131 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 94 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 130 >SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 49 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 85 >SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) Length = 143 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 104 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 140 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 145 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 181 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 95 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 131 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 263 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 299 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 95 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 131 >SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 43 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 79 >SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 81 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 117 >SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 31 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 67 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 90 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 126 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 439 DAPCSGALSAAGVVVTRSVSRYTCQRPSARSF-RFLP 332 DAPCSGALSAAGVVVTRSV+ R F R+ P Sbjct: 95 DAPCSGALSAAGVVVTRSVTATLASADVRRCFCRYAP 131 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,540,322 Number of Sequences: 59808 Number of extensions: 486988 Number of successful extensions: 4613 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4582 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -