BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0223.Seq (801 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57380.1 68418.m07169 fibronectin type III domain-containing ... 30 2.1 At1g19230.1 68414.m02393 respiratory burst oxidase protein E (Rb... 30 2.1 At4g33630.2 68417.m04778 expressed protein 28 8.3 At4g33630.1 68417.m04777 expressed protein 28 8.3 At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) fa... 28 8.3 >At5g57380.1 68418.m07169 fibronectin type III domain-containing protein / PHD finger protein-related contains Pfam profiles PF00041: Fibronectin type III domain, PF00628: PHD-finger Length = 600 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 95 DRDRVECCSSLEQESTIKERGLQRQRAKNRLSGR 196 D+D E CS+ E ES ++E L +++A N++ GR Sbjct: 434 DKDNTEHCSAGEVESELEEERLVKRKA-NKIDGR 466 >At1g19230.1 68414.m02393 respiratory burst oxidase protein E (RbohE) / NADPH oxidase nearly identical to respiratory burst oxidase protein E GI:3242787 [gi:3242787] from [Arabidopsis thaliana] Length = 926 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +1 Query: 151 TWTPTSK--GEKPSIRAMAHYVNHHPNQVFWGRGAVNTKSE 267 T TPTS G+K +++A ++V P V W RG + S+ Sbjct: 777 TATPTSTHGGKKKAVKAHFYWVTREPGSVEWFRGVMEEISD 817 >At4g33630.2 68417.m04778 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 361 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 263 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At4g33630.1 68417.m04777 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 361 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 263 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) family protein similar to C-terminal zinc-finger [Glycine max] GI:558543; contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 486 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 157 TPTSKGEKPSIRAMAHYVNHHP 222 T +S+ PS+ HY++HHP Sbjct: 260 TSSSRNPTPSVYQRNHYISHHP 281 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,553,907 Number of Sequences: 28952 Number of extensions: 339539 Number of successful extensions: 874 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -