Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesV0222.Seq
         (819 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g11660.1 68416.m01429 harpin-induced family protein / HIN1 fa...    28   6.5  

>At3g11660.1 68416.m01429 harpin-induced family protein / HIN1
           family protein / harpin-responsive family protein
           similar to harpin-induced protein hin1 (GI:1619321)
           [Nicotiana tabacum]
          Length = 209

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 5/63 (7%)
 Frame = -1

Query: 813 VKILGPFKYPQ-----PXAGXKLITENMVGAYL*NGLATLNGRVNWKINTFYSGSKKTKL 649
           V I  PF Y       P  G  L T+   G  L   +   +GRV WK+ TF +G     +
Sbjct: 118 VDIWSPFVYGTSVPIAPFNGVSLDTDKDNGVVLL--IIRADGRVRWKVGTFITGKYHLHV 175

Query: 648 KRP 640
           K P
Sbjct: 176 KCP 178


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,913,184
Number of Sequences: 28952
Number of extensions: 295537
Number of successful extensions: 560
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 549
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 560
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1872844800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)