BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0221.Seq (801 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 5.0 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 8.7 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/39 (25%), Positives = 16/39 (41%) Frame = +2 Query: 617 LWEDRTAQENLCMWARAVHEVPRFPGKLVSFSWLRLTFP 733 +W D E + + + P+FP + V R FP Sbjct: 193 IWFDEVVNELRILHGVEIRDYPKFPYRGVMIDTARNFFP 231 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 87 DNLQYQFFPVSSGSVQFKVRAAND 158 DNLQY F SG++ + + D Sbjct: 201 DNLQYSFDNQCSGTIDWALPKQED 224 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,861 Number of Sequences: 336 Number of extensions: 4466 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -