BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0219.Seq (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 36 0.024 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 36 0.024 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 30 1.5 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 30 1.5 At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transfera... 29 3.6 At4g11270.1 68417.m01823 transducin family protein / WD-40 repea... 28 8.3 At3g47620.1 68416.m05184 TCP family transcription factor, putati... 28 8.3 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 36.3 bits (80), Expect = 0.024 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 4/83 (4%) Frame = +2 Query: 89 MSSSNKELE-EKLY--NSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDKSRNTRS 259 M N+ E EKL+ NS L+ Y ++ S ++ENQ K + QNV ++DK R ++ Sbjct: 288 MEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRTEQA 347 Query: 260 TATSCG-SATDSTLSESTSPITL 325 + S G S ++ S T ++L Sbjct: 348 GSFSRGPSEFEANGSHGTDTLSL 370 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 36.3 bits (80), Expect = 0.024 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 4/83 (4%) Frame = +2 Query: 89 MSSSNKELE-EKLY--NSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDKSRNTRS 259 M N+ E EKL+ NS L+ Y ++ S ++ENQ K + QNV ++DK R ++ Sbjct: 289 MEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRTEQA 348 Query: 260 TATSCG-SATDSTLSESTSPITL 325 + S G S ++ S T ++L Sbjct: 349 GSFSRGPSEFEANGSHGTDTLSL 371 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 2/71 (2%) Frame = +2 Query: 119 KLYNSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDKSRNTRSTATS--CGSATDS 292 K+ + IL+G D A EY Q K IQN++NN ++ R + Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMVRSYEKIREEEIKRMIEKLEKA 162 Query: 293 TLSESTSPITL 325 + S S SP+ L Sbjct: 163 SCSSSPSPVNL 173 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 2/71 (2%) Frame = +2 Query: 119 KLYNSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDKSRNTRSTATS--CGSATDS 292 K+ + IL+G D A EY Q K IQN++NN ++ R + Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMVRSYEKIREEEIKRMIEKLEKA 162 Query: 293 TLSESTSPITL 325 + S S SP+ L Sbjct: 163 SCSSSPSPVNL 173 >At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 484 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = +2 Query: 128 NSILTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDKSRNTRSTATSCGSATDSTLSES 307 N + TG+ + + + E N+GKG II+ ++I + T CG +STL Sbjct: 326 NQVGTGENEDWLPKGFEERNKGKGLIIRGWAPQVLILDHKAIGGFVTHCG--WNSTLEGI 383 Query: 308 TSPITLDSSWP 340 + + + +WP Sbjct: 384 AAGLPM-VTWP 393 >At4g11270.1 68417.m01823 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to TGF-beta resistance-associated protein TRAG (GI:15624071) {Mus musculus}; similar to beta-transducin repeats containing protein - Homo sapiens,PID:e1284220; 3' EST no_NP:TC8031 Length = 1446 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = -2 Query: 289 VRCRPTACSSTPGVPTLVNDQVVNYILDDGALALVLVFQALTDSAVVVTGEDAVVQFL-L 113 + C ++ + VP+ + + +V +L A+A VL F ++ +S + T D+ V + L Sbjct: 1142 IECVSSSVGAYQVVPSSIKETLVEVLLPSLAMADVLGFLSIIESQIWSTASDSPVHVVSL 1201 Query: 112 EFFVRTAHAS 83 +R A+ Sbjct: 1202 RTLIRIIRAA 1211 >At3g47620.1 68416.m05184 TCP family transcription factor, putative auxin-induced basic helix-loop-helix transcription factor - Gossypium hirsutum, EMBL:AF165924 Length = 489 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/65 (23%), Positives = 27/65 (41%) Frame = -2 Query: 202 GALALVLVFQALTDSAVVVTGEDAVVQFLLEFFVRTAHASRGHFSDAGADGEHARREHHE 23 GA++ L F +TG+ + ++ + G SD G D + +R HH Sbjct: 391 GAVSSGLHFMNFAAPMAFLTGQQQLATTSNHEINEDSNNNEGGRSDGGGDHHNTQRHHHH 450 Query: 22 KFHYH 8 + +H Sbjct: 451 QQQHH 455 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,313,396 Number of Sequences: 28952 Number of extensions: 289998 Number of successful extensions: 861 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -