BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0218.Seq (847 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 23 3.0 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 23 3.0 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 22 5.3 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 7.0 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = +3 Query: 315 YNFRLIMAGNFVKLIYRNYNLALKLGPTLDPANEXLAYGDGKEKN 449 Y L V L + YNL+L + D N + +EKN Sbjct: 169 YTLHLFCVLYVVLLHFLTYNLSLGIKLRYDDVNNLFRIEESEEKN 213 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = +3 Query: 315 YNFRLIMAGNFVKLIYRNYNLALKLGPTLDPANEXLAYGDGKEKN 449 Y L V L + YNL+L + D N + +EKN Sbjct: 169 YTLHLFCVLYVVLLHFLTYNLSLGIKLRYDDVNNLFRIEESEEKN 213 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 627 NCSPGGVGRCWCPNI 583 +C PG G+C+ P+I Sbjct: 47 SCGPGQSGQCFGPSI 61 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +2 Query: 458 HQLEVHYLVGEQQSVLQIHNTKYNP 532 H+LE + + + +H +K+NP Sbjct: 97 HELETKFNPHHEIKLQHLHQSKFNP 121 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,805 Number of Sequences: 336 Number of extensions: 3042 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -