BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0217.Seq (797 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 25 0.70 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 25 0.70 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 24 1.6 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 6.5 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 25.0 bits (52), Expect = 0.70 Identities = 13/42 (30%), Positives = 17/42 (40%) Frame = -2 Query: 670 SCRRDCPYRRIAITHFILIVYSCYAPTCHCLHPFVSAQQWVH 545 +CR P RI HF L +Y+ C P + W H Sbjct: 111 ACREGEP-PRICYYHFTLELYTVLGAACQVCTPNATNTVWSH 151 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 25.0 bits (52), Expect = 0.70 Identities = 13/42 (30%), Positives = 17/42 (40%) Frame = -2 Query: 670 SCRRDCPYRRIAITHFILIVYSCYAPTCHCLHPFVSAQQWVH 545 +CR P RI HF L +Y+ C P + W H Sbjct: 111 ACREGEP-PRICYYHFTLELYTVLGAACQVCTPNATNTVWSH 151 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 431 SRRGIFEKLQQLAFPLSHRLPMF 499 S + EKLQ A L+HR P F Sbjct: 609 SNPSLEEKLQIFALQLTHRAPTF 631 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 587 SLLTPIRLSSAMGSYTCQPSSGKL 516 SLL +R SS G TC+ K+ Sbjct: 621 SLLDKMRDSSGAGRITCEKCGNKI 644 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,793 Number of Sequences: 336 Number of extensions: 4296 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -