BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0214.Seq (599 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28577| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.00012) 29 3.8 SB_51536| Best HMM Match : Trypsin (HMM E-Value=0) 28 5.0 >SB_28577| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.00012) Length = 281 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 227 VMPTLY*EMFVTVHSARRPPGGSDQPPDGEVC 132 V+PTL S RRPP + PP G VC Sbjct: 210 VLPTLPPTKAPPPRSTRRPPPDTPAPPSGGVC 241 >SB_51536| Best HMM Match : Trypsin (HMM E-Value=0) Length = 347 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 428 FLVRQIYGYTKVRAMYREFIEIIKL*RDKRGRCSKFCQFC 547 F V+ + A+Y+ F ++ K R C+K+C+FC Sbjct: 49 FCVKPCFDKHTKCAVYKNFCKVPKYEGAMRHWCNKYCEFC 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,504,987 Number of Sequences: 59808 Number of extensions: 306100 Number of successful extensions: 695 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -