BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0210.Seq (797 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 8.6 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 8.6 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 8.6 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/40 (25%), Positives = 16/40 (40%) Frame = -2 Query: 187 PXTASKKDLPSRYDPSSSHVGVLEVRVLHQLVDQSRMPDT 68 P S +DL S S + ++H L+ P+T Sbjct: 190 PVILSGRDLMSCAQTGSGKTAAFMLPIIHNLLSDKNPPNT 229 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +2 Query: 263 YTNDIPTLEGNLQAWEVDVKLALFADDS 346 + N+IPT+ +++ + +LAL A S Sbjct: 321 WLNEIPTMPVSIKDQTIKEELALLAQQS 348 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.4 bits (43), Expect = 8.6 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +3 Query: 624 PLPXSRFPPPG 656 P+P + +PPPG Sbjct: 207 PVPSTPYPPPG 217 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,909 Number of Sequences: 336 Number of extensions: 3259 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -