BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0210.Seq (797 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26F1.01 |sec74|SPAPJ691.01c|guanyl-nucleotide exchange facto... 28 1.8 SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22... 27 4.1 >SPAC26F1.01 |sec74|SPAPJ691.01c|guanyl-nucleotide exchange factor Sec74|Schizosaccharomyces pombe|chr 1|||Manual Length = 928 Score = 27.9 bits (59), Expect = 1.8 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = -3 Query: 582 LRSISTPKYRTLDLNSTLAPTETELPGTTVVRTGPKRIAAVFPTLTATLHRSS 424 + S+ K ++++ +S A TET VVR P ++ + +T HR S Sbjct: 865 VESVQNTKLKSVENDSGKAETETVGKNPEVVRKSPAKLPNIANIMTVNGHRYS 917 >SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22|Schizosaccharomyces pombe|chr 3|||Manual Length = 1680 Score = 26.6 bits (56), Expect = 4.1 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 326 PTSRLLPTLGGYPRAXXXXXXXXXXXWSQDASLRNSGR 213 P+S L+P G PR SQ++SL SGR Sbjct: 1470 PSSTLMPRKRGRPRKKTNSGSSLSTPLSQESSLARSGR 1507 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,968,739 Number of Sequences: 5004 Number of extensions: 56895 Number of successful extensions: 173 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 173 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 389395636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -