BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0207.Seq (485 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 35 0.041 SB_38600| Best HMM Match : Ank (HMM E-Value=6.9e-36) 29 2.0 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) 27 6.2 SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 34.7 bits (76), Expect = 0.041 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 3/78 (3%) Frame = -1 Query: 446 ENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATTRSEAQRAL---YVHTRQR 276 E EK+ + EL+ S HF E ++R RA+ED+ +SE ++ L H R Sbjct: 332 EEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKELQKQVEHLTTR 391 Query: 275 SVARERRSVTSNAHRSSH 222 +E+ + R H Sbjct: 392 LKFQEQEIAQAMEQRKKH 409 >SB_38600| Best HMM Match : Ank (HMM E-Value=6.9e-36) Length = 852 Score = 29.1 bits (62), Expect = 2.0 Identities = 20/54 (37%), Positives = 28/54 (51%) Frame = +2 Query: 197 VISEPPYPNENCDGRLKSRFSVPERRSSDEYGRRARVELRSASWHRGLQELWRL 358 + +EPP+ +C G +SR RR+S E R RV + HR L +L RL Sbjct: 686 IATEPPWFGGDCFGISESRRPGISRRTSAESSRN-RVRYCKHTRHRLLSQLKRL 738 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = -3 Query: 405 SGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRSGTEKRDFKRPS 232 S +SP+ P RTT S ++S + R++ R +SS +RR+ +E +P+ Sbjct: 155 SSKSPSPPTNRTTQGESPKTSSSGHGQHSSRTAVRRSASFSSSQRRT-SESESRSKPA 211 >SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 Query: 368 RQRTASRALEDRGATTRSEAQRALYVHTRQRSVARERRSVTSNAHR 231 ++ ++ LED A E + L V +QR V E R + A R Sbjct: 155 QEELRNKILEDVQALQEDERNKTLQVRNKQREVEIEHREYAARAER 200 >SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 320 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 433 A+W G E WRL + G++ W L ++ S G Sbjct: 62 ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 99 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 320 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 433 A+W G E WRL + G++ W L ++ S G Sbjct: 78 ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 115 >SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) Length = 259 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 211 RLTDHLTTASNGSDSSSRGTEYST 140 RLT++ +ASNGSD + E ST Sbjct: 2 RLTNYTLSASNGSDDETSNKEVST 25 >SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 27.1 bits (57), Expect = 8.2 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 313 SLRVVAPRSSRALEAVRCRGSDVGKCRRLAA*YCNSLFERC 435 ++RV+APR + A E S+ C R AA + E C Sbjct: 57 NIRVIAPRKATASELAAFHSSEYVNCMRRAAEAVSDGSEEC 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,060,894 Number of Sequences: 59808 Number of extensions: 249729 Number of successful extensions: 887 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -