BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0206.Seq (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 81 1e-15 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 80.6 bits (190), Expect = 1e-15 Identities = 36/61 (59%), Positives = 40/61 (65%) Frame = +2 Query: 254 QTSAESWGTGRAVARIPXXXXXXXXXXXXXXXXNMCRXXRXFAPTKPWRRWHRRVNLRQR 433 QTSAESWGTGRAVARIP NMCR R FAPTK WR+WH +VN++QR Sbjct: 58 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWHTKVNVQQR 117 Query: 434 R 436 R Sbjct: 118 R 118 Score = 70.9 bits (166), Expect = 9e-13 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = +3 Query: 81 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHK 257 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AGH+ Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQ 58 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 148 GRGLAAPCTVSLFSEYTDTKGRATDRLI 65 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -3 Query: 329 YGYHHHGHAEFGQQHVRYPMI-RHWFVTSLLAHAVGLP-RVLGHRNVN 192 Y +HHHG E Q V I R W L +H P RV+G ++ Sbjct: 22 YQWHHHGTGETDDQPVTTTRITRTWVNRRLNSHRTIKPSRVIGRAQIH 69 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,053,944 Number of Sequences: 59808 Number of extensions: 282165 Number of successful extensions: 638 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 633 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -