BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0206.Seq (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 80 2e-15 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 80 2e-15 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 2.2 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 5.0 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 79.8 bits (188), Expect = 2e-15 Identities = 36/61 (59%), Positives = 39/61 (63%) Frame = +2 Query: 254 QTSAESWGTGRAVARIPXXXXXXXXXXXXXXXXNMCRXXRXFAPTKPWRRWHRRVNLRQR 433 QTSAESWGTGRAV+RIP NMCR R FAPTK WRRWHRRVN+ + Sbjct: 67 QTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVNMK 126 Query: 434 R 436 R Sbjct: 127 R 127 Score = 66.1 bits (154), Expect = 2e-11 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +3 Query: 75 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 248 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 249 GHK 257 GH+ Sbjct: 65 GHQ 67 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 79.8 bits (188), Expect = 2e-15 Identities = 36/61 (59%), Positives = 39/61 (63%) Frame = +2 Query: 254 QTSAESWGTGRAVARIPXXXXXXXXXXXXXXXXNMCRXXRXFAPTKPWRRWHRRVNLRQR 433 QTSAESWGTGRAV+RIP NMCR R FAPTK WRRWHRRVN+ + Sbjct: 66 QTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVNMK 125 Query: 434 R 436 R Sbjct: 126 R 126 Score = 68.1 bits (159), Expect = 5e-12 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 2/66 (3%) Frame = +3 Query: 66 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 239 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 240 KEAGHK 257 K+AGH+ Sbjct: 61 KKAGHQ 66 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +3 Query: 90 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 236 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 141 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 236 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 141 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 236 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,079,580 Number of Sequences: 28952 Number of extensions: 190421 Number of successful extensions: 521 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 516 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -