BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0204.Seq (797 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 23 8.3 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 23 8.3 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.4 bits (48), Expect = 8.3 Identities = 8/37 (21%), Positives = 16/37 (43%) Frame = -3 Query: 261 HPCRIRARRTSSPPTELFCRRNTCSKFDESFALLFQW 151 +P ++ T P + DE+F +++QW Sbjct: 237 YPDEEKSGETDDPDNPTYLVHQHTQNLDETFDMMYQW 273 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 23.4 bits (48), Expect = 8.3 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +2 Query: 2 ARALLFSLLFKFYFNTYLPKKVKF 73 ++ L +L +F F+ +P+K+KF Sbjct: 448 SKIALVMMLSRFNFSATIPRKIKF 471 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 840,397 Number of Sequences: 2352 Number of extensions: 18261 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -