BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0201.Seq (797 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 24 1.2 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 2.1 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 22 4.9 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 22 6.5 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 22 6.5 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 492 QIYQTAYHKELVPHTSLPEHV 554 +IYQT + PH LP+HV Sbjct: 79 RIYQTLLSGKNHPHIQLPKHV 99 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 668 NLQPGQLVXDFHCH-H*HSGV*PKSPELXGARXPEPG 775 +++ G +V H H H H G + P+ GA P+PG Sbjct: 12 DMRNGGVVSAEHPHQHQHYGAAVQVPQGGGAVQPDPG 48 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +3 Query: 153 WSPVCXTCCXNYDPRDHGGIQI 218 WS + C P+ GG+QI Sbjct: 38 WSDIADVCERFLAPKGFGGVQI 59 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +3 Query: 153 WSPVCXTCCXNYDPRDHGGIQI 218 WS + C P+ GG+QI Sbjct: 37 WSDIADECERFLAPKGFGGVQI 58 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +3 Query: 153 WSPVCXTCCXNYDPRDHGGIQI 218 WS + C P+ GG+QI Sbjct: 38 WSDIADECERFLAPKGFGGVQI 59 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,169 Number of Sequences: 336 Number of extensions: 3392 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -