BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0201.Seq (797 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 24 6.3 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 6.3 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 23.8 bits (49), Expect = 6.3 Identities = 12/37 (32%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 254 NSNGGTCSTNKTDEDGCEVRDIYAIRSHGYCS-ACAK 361 N GGT T C +Y + + CS AC K Sbjct: 215 NRFGGTVDETSTGTPKCTSNGLYCVHNKDCCSGACYK 251 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +3 Query: 42 NGTCQSLKTN*INRSIENKQNSNNVAKAAALNFIREHW 155 NG+C S ++ N S + +SN+ A + H+ Sbjct: 1087 NGSCSSTSSSHSNHSSHSSSSSNSAGSWAGMGKQESHY 1124 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 765,359 Number of Sequences: 2352 Number of extensions: 14411 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -