BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0201.Seq (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39400.1 68417.m05577 brassinosteroid insensitive 1 (BRI1) id... 29 2.7 At3g13380.1 68416.m01683 leucine-rich repeat family protein / pr... 29 3.6 At2g21630.1 68415.m02573 transport protein, putative similar to ... 29 3.6 >At4g39400.1 68417.m05577 brassinosteroid insensitive 1 (BRI1) identical to GI:2392895 Length = 1196 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 572 VSVNVEAFTKATFNLTYEELLEYRNGVYNHAV 667 +S+N+ AF K LT+ +LL+ NG +N ++ Sbjct: 857 LSINLAAFEKPLRKLTFADLLQATNGFHNDSL 888 >At3g13380.1 68416.m01683 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1164 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 557 SXHFTVSVNVEAFTKATFNLTYEELLEYRNG 649 S H +S+NV F K LT+ LLE NG Sbjct: 827 SVHEPLSINVATFEKPLRKLTFAHLLEATNG 857 >At2g21630.1 68415.m02573 transport protein, putative similar to Swiss-Prot:Q15436 protein transport protein Sec23A [Homo sapiens] Length = 761 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +2 Query: 563 HFTVSVNVEAFTKATFNLTYEELLEYRNGVYNHAVNLQPGQLVXDFH 703 H S V+ F + Y ++ YR V N V +QP + FH Sbjct: 587 HLRRSQFVQVFNNSPDETAYFRMILYRENVSNSVVMIQPSLISFSFH 633 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,632,686 Number of Sequences: 28952 Number of extensions: 296495 Number of successful extensions: 687 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -