BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0200.Seq (797 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366... 33 0.20 06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399,437... 30 2.5 03_05_0938 - 28978696-28978809,28978942-28979028,28979124-289792... 29 4.3 06_03_0095 - 16575938-16576585,16577028-16577219,16577294-165773... 28 9.9 >08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870, 3661975-3662133,3662193-3662243,3662838-3663018, 3663102-3663228,3663322-3663431,3663529-3663667, 3663767-3663876,3664002-3664071,3664247-3664320, 3664458-3664553,3664682-3664777,3665041-3665168, 3665422-3665656,3665743-3665910,3666274-3666381, 3666468-3666617,3666905-3667015,3667118-3667297, 3667427-3667555,3667819-3667914,3668108-3668293, 3668431-3668603,3668720-3668921 Length = 1150 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 284 RCPWSPGAKVIGVLHAVHLVVSYQFV 207 RC WSP ++GV + H+V +Y FV Sbjct: 430 RCLWSPDGSILGVAFSKHIVQTYAFV 455 >06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399, 4375942-4376137,4376385-4376451,4376895-4376998, 4377090-4377174,4377309-4377369,4377694-4377825, 4377924-4377993,4379261-4379413,4379583-4379694, 4379779-4379920,4380023-4380140,4380862-4380957, 4381061-4381189 Length = 593 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 183 SEVITNVVNKLIRNN--KMNCMEYAYNFGSRAPRTSSGIVSQLSSDLSSPKTRLSLCTS 353 SE I+++ N+L R+ K+ C N S A I S+L S LS+ TRL CTS Sbjct: 343 SEFISHLANQLARHQFLKIACQLERKNIAS-AYSLLRVIESELQSYLSAVNTRLGHCTS 400 >03_05_0938 - 28978696-28978809,28978942-28979028,28979124-28979256, 28979592-28979865,28980242-28980368,28980523-28980773, 28980854-28980935 Length = 355 Score = 29.1 bits (62), Expect = 4.3 Identities = 21/69 (30%), Positives = 28/69 (40%) Frame = -2 Query: 760 GTSRINSCRCNPKAMR*PEGLNRPRQCQSXAVFTXVDVEQDVIVVLSRLQVPLGSETIDA 581 G N P+A P G N PR + A +DV + L+RL G ++ Sbjct: 13 GAPAANPAAPPPRAPGPPRGPNAPRAGGAPAKVLPIDVPAVALAELNRLTGNFGDRSL-- 70 Query: 580 VDSEGPYGR 554 EG YGR Sbjct: 71 -VGEGSYGR 78 >06_03_0095 - 16575938-16576585,16577028-16577219,16577294-16577392, 16577496-16577618,16577717-16577929,16578143-16578251, 16578339-16578427,16578604-16578880,16578974-16579084, 16579160-16580508,16581218-16581631 Length = 1207 Score = 27.9 bits (59), Expect = 9.9 Identities = 23/74 (31%), Positives = 35/74 (47%) Frame = -2 Query: 394 ALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPDDVLGALEPKL*AYSMQFILLFRI 215 +L +IA S + K + + GE K W PDD +PK A + F LL + Sbjct: 316 SLLVIALLGSVLFGIWTKEDLMNGEMK---RWYLRPDDSTIFYDPKRAALASFFHLLTAL 372 Query: 214 SLFTTFVMTSLFFS 173 L++ F+ SL+ S Sbjct: 373 MLYSYFIPISLYIS 386 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,977,404 Number of Sequences: 37544 Number of extensions: 352345 Number of successful extensions: 958 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -