BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0092.Seq (914 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 42 7e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 41 0.001 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 41 0.001 SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45924| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 39 0.005 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 39 0.006 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 39 0.006 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 39 0.006 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 38 0.009 SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 38 0.011 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 38 0.015 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 38 0.015 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 38 0.015 SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 37 0.020 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 37 0.020 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 37 0.020 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 37 0.026 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 37 0.026 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 37 0.026 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) 37 0.026 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) 37 0.026 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_11224| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 36 0.035 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 36 0.035 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 36 0.035 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 36 0.035 SB_35386| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.035 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 36 0.035 SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 36 0.035 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 36 0.046 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.046 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 36 0.046 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.046 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.046 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 36 0.046 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 36 0.046 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 36 0.046 SB_42354| Best HMM Match : GETHR (HMM E-Value=5.3) 36 0.046 SB_41271| Best HMM Match : EGF (HMM E-Value=1.2e-20) 36 0.046 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 36 0.046 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 36 0.046 SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) 36 0.046 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 36 0.046 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 36 0.060 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.060 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) 36 0.060 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.060 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_47449| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_44042| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_39747| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_35366| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) 36 0.060 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_30384| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_25775| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_17580| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 36 0.060 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.060 SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) 36 0.060 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_13217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 36 0.060 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_783| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 36 0.060 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 35 0.080 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 35 0.080 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 35 0.080 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 35 0.080 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 35 0.080 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 35 0.080 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 35 0.080 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 35 0.080 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 35 0.080 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 35 0.080 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 35 0.080 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 35 0.080 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 35 0.080 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 35 0.080 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 35 0.080 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 35 0.080 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 35 0.080 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 35 0.080 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -2 Query: 97 EKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 E+R+ T ++ + PG PL LERPPPRWS Sbjct: 217 EQRNYTQLLESSNSCSPGDPLVLERPPPRWS 247 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 TS + R+ PG PL LERPPPRWS Sbjct: 870 TSTVKRSNSCSPGDPLVLERPPPRWS 895 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R T+ ++ A+ +PG PL LERPPPRWS Sbjct: 328 RSVTATLASADVRRPGDPLVLERPPPRWS 356 >SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 + R E QPG PL LERPPPRWS Sbjct: 29 VDRIEFLQPGDPLVLERPPPRWS 51 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -2 Query: 100 YEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 + S S +S + PG PL LERPPPRWS Sbjct: 3 WNSHPSASFLSSSNSCSPGDPLVLERPPPRWS 34 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 +T+ ++R+ PG PL LERPPPRWS Sbjct: 6 TTTTLTRSNSCSPGDPLVLERPPPRWS 32 >SB_45924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -2 Query: 94 KRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 K+D +I E G PL LERPPPRWS Sbjct: 38 KKDQNDVIELIESCSTGDPLVLERPPPRWS 67 >SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 106 RLYEKRDSTSI-ISRAEXXQPGHPLXLERPPPRWS 5 ++ E T + IS +E PG PL LERPPPRWS Sbjct: 113 KISESEPETFVKISESEPETPGDPLVLERPPPRWS 147 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 S+ SR+ PG PL LERPPPRWS Sbjct: 20 SLRSRSNSCSPGDPLVLERPPPRWS 44 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I R+ PG PL LERPPPRWS Sbjct: 10 SANIFFRSNSCSPGDPLVLERPPPRWS 36 >SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = -2 Query: 94 KRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 K DS +I PG PL LERPPPRWS Sbjct: 128 KLDSKRLIKLTYRNSPGDPLVLERPPPRWS 157 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -2 Query: 88 DSTSIISRAEXXQPGHPLXLERPPPRWS 5 DS + R+ PG PL LERPPPRWS Sbjct: 17 DSPIVEKRSNSCSPGDPLVLERPPPRWS 44 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 S+ S++ PG PL LERPPPRWS Sbjct: 19 SVASQSNSCSPGDPLVLERPPPRWS 43 >SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 T+I+ E PG PL LERPPPRWS Sbjct: 504 TAILYSKEDAAPGDPLVLERPPPRWS 529 >SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 140 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I+ + PG PL LERPPPRWS Sbjct: 10 SANIVGSSNPRSPGDPLVLERPPPRWS 36 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = -2 Query: 100 YEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 Y KR+S S + + PG PL LERPPPRWS Sbjct: 15 YPKRNSNSHTA-SNSCSPGDPLVLERPPPRWS 45 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 +SR+ PG PL LERPPPRWS Sbjct: 62 LSRSNSCSPGDPLVLERPPPRWS 84 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I R+ PG PL LERPPPRWS Sbjct: 10 SANIPKRSNSCSPGDPLVLERPPPRWS 36 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/38 (52%), Positives = 24/38 (63%) Frame = -2 Query: 118 NY*ARLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 N A Y R+S++I S + PG PL LERPPPRWS Sbjct: 7 NIQATSYFLRNSSNISSNS--CSPGDPLVLERPPPRWS 42 >SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = -2 Query: 136 LRAQQTNY*ARLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 +RA+ + + +R +T I+ PG PL LERPPPRWS Sbjct: 299 VRARTRTWYTVMRGQRANTLIVQSICGFSPGDPLVLERPPPRWS 342 >SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) Length = 333 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S AE PG PL LERPPPRWS Sbjct: 208 SGAEYQSPGDPLVLERPPPRWS 229 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -2 Query: 97 EKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 +K+++ + I + PG PL LERPPPRWS Sbjct: 92 KKKNAVTRIRTSNSCSPGDPLVLERPPPRWS 122 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/45 (44%), Positives = 29/45 (64%) Frame = -2 Query: 139 VLRAQQTNY*ARLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 +LRA++ N + + + +T I+S + PG PL LERPPPRWS Sbjct: 57 ILRARKANAQVQKHHRGVNT-IVSNS--CSPGDPLVLERPPPRWS 98 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -2 Query: 106 RLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 RLY KR S S R+ PG PL LERPPPRWS Sbjct: 16 RLY-KRLSKS--KRSNSCSPGDPLVLERPPPRWS 46 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 SI S + PG PL LERPPPRWS Sbjct: 34 SITSTSNSCSPGDPLVLERPPPRWS 58 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 RD + + + PG PL LERPPPRWS Sbjct: 142 RDLEEVANSSNSCSPGDPLVLERPPPRWS 170 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -2 Query: 88 DSTSIISRAEXXQPGHPLXLERPPPRWS 5 D+++++ + PG PL LERPPPRWS Sbjct: 82 DASNLLLTSNSCSPGDPLVLERPPPRWS 109 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I++ + PG PL LERPPPRWS Sbjct: 10 SANILAGSNSCSPGDPLVLERPPPRWS 36 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 SR+ PG PL LERPPPRWS Sbjct: 28 SRSNSCSPGDPLVLERPPPRWS 49 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I R+ PG PL LERPPPRWS Sbjct: 10 SANIKFRSNSCSPGDPLVLERPPPRWS 36 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 +II ++ PG PL LERPPPRWS Sbjct: 20 NIIRQSNSCSPGDPLVLERPPPRWS 44 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 T ++ ++ PG PL LERPPPRWS Sbjct: 182 TDLVIQSNSCSPGDPLVLERPPPRWS 207 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/32 (56%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 97 EKRDSTSI-ISRAEXXQPGHPLXLERPPPRWS 5 EKR I + R+ PG PL LERPPPRWS Sbjct: 14 EKRFRVIIAVRRSNSCSPGDPLVLERPPPRWS 45 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = -2 Query: 130 AQQTNY*ARLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 A Q +Y L+E + +S + PG PL LERPPPRWS Sbjct: 66 ATQNSYVEYLHESVPKSEPLS-SNSCSPGDPLVLERPPPRWS 106 >SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 106 RLYEKRDSTSIISRAEXXQ-PGHPLXLERPPPRWS 5 R +R + +SR + + PG PL LERPPPRWS Sbjct: 71 RSRRRRQKAASLSRRDSYENPGDPLVLERPPPRWS 105 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I+ + PG PL LERPPPRWS Sbjct: 10 SANILHASNSCSPGDPLVLERPPPRWS 36 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 T +I + PG PL LERPPPRWS Sbjct: 21 TEVIITSNSCSPGDPLVLERPPPRWS 46 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 SR+ PG PL LERPPPRWS Sbjct: 6 SRSNSCSPGDPLVLERPPPRWS 27 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 T I + + PG PL LERPPPRWS Sbjct: 4 TGITTTSNSCSPGDPLVLERPPPRWS 29 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.011 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 ++R+ PG PL LERPPPRWS Sbjct: 2 LARSNSCSPGDPLVLERPPPRWS 24 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = -2 Query: 94 KRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 KR S R+ PG PL LERPPPRWS Sbjct: 4 KRKFGSNAVRSNSCSPGDPLVLERPPPRWS 33 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = -2 Query: 148 RARVLRAQQTNY*ARLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 +AR L + +L ++ IIS + PG PL LERPPPRWS Sbjct: 95 KARPLTEMGRSLCRQLVRAKNQKEIISNS--CSPGDPLVLERPPPRWS 140 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 37.9 bits (84), Expect = 0.011 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 ++ ++ PG PL LERPPPRWS Sbjct: 68 VVQKSNSCSPGDPLVLERPPPRWS 91 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I+ + PG PL LERPPPRWS Sbjct: 10 SANIVHISNSCSPGDPLVLERPPPRWS 36 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 37.9 bits (84), Expect = 0.011 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = -2 Query: 109 ARLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 A+++ ++ + ++ + PG PL LERPPPRWS Sbjct: 66 AKVHCRKQRSREVATSNSCSPGDPLVLERPPPRWS 100 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -2 Query: 94 KRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 ++ + S R+ PG PL LERPPPRWS Sbjct: 6 RKSNASRTLRSNSCSPGDPLVLERPPPRWS 35 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 T R+ PG PL LERPPPRWS Sbjct: 3 TDAYERSNSCSPGDPLVLERPPPRWS 28 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S ++ S A PG PL LERPPPRWS Sbjct: 51 SEALKSLARSHSPGDPLVLERPPPRWS 77 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -2 Query: 88 DSTSIISRAEXXQPGHPLXLERPPPRWS 5 +S S R+ PG PL LERPPPRWS Sbjct: 13 NSLSYSFRSNSCSPGDPLVLERPPPRWS 40 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 II+ + PG PL LERPPPRWS Sbjct: 59 IITTSNSCSPGDPLVLERPPPRWS 82 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 + + S +R+ PG PL LERPPPRWS Sbjct: 18 KTANSKATRSNSCSPGDPLVLERPPPRWS 46 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 ST + + PG PL LERPPPRWS Sbjct: 6 STEVYLASNSCSPGDPLVLERPPPRWS 32 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R+ +I + PG PL LERPPPRWS Sbjct: 38 RNDVLVIGISNSCSPGDPLVLERPPPRWS 66 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R + SI + PG PL LERPPPRWS Sbjct: 26 RSTVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.015 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 + R+ PG PL LERPPPRWS Sbjct: 10 LERSNSCSPGDPLVLERPPPRWS 32 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S I S + PG PL LERPPPRWS Sbjct: 29 SVIIASLSNSCSPGDPLVLERPPPRWS 55 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 37.5 bits (83), Expect = 0.015 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 +S++ PG PL LERPPPRWS Sbjct: 60 LSQSNSCSPGDPLVLERPPPRWS 82 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = -2 Query: 94 KRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 KRD +S + PG PL LERPPPRWS Sbjct: 5 KRDER--LSTSNSCSPGDPLVLERPPPRWS 32 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -2 Query: 97 EKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 +++D +R+ PG PL LERPPPRWS Sbjct: 53 KRKDKRLGHARSNSCSPGDPLVLERPPPRWS 83 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R + SI + PG PL LERPPPRWS Sbjct: 26 RSTVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S S +R+ PG PL LERPPPRWS Sbjct: 86 SMSQHARSNSCSPGDPLVLERPPPRWS 112 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -2 Query: 79 SIISRAEXXQ--PGHPLXLERPPPRWS 5 +++S+AE PG PL LERPPPRWS Sbjct: 111 ALVSKAESNSCSPGDPLVLERPPPRWS 137 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R + SI + PG PL LERPPPRWS Sbjct: 26 RSTVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.5 bits (83), Expect = 0.015 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 + R+ PG PL LERPPPRWS Sbjct: 27 LQRSNSCSPGDPLVLERPPPRWS 49 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R + SI + PG PL LERPPPRWS Sbjct: 26 RSTVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R + SI + PG PL LERPPPRWS Sbjct: 26 RSTVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -2 Query: 88 DSTSIISRAEXXQPGHPLXLERPPPRWS 5 + T+ S + PG PL LERPPPRWS Sbjct: 350 EKTNEASASNSCSPGDPLVLERPPPRWS 377 >SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 37.5 bits (83), Expect = 0.015 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 + +A PG PL LERPPPRWS Sbjct: 19 VPKASQHSPGDPLVLERPPPRWS 41 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R + SI + PG PL LERPPPRWS Sbjct: 26 RSTVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 IS + PG PL LERPPPRWS Sbjct: 4 ISASNSCSPGDPLVLERPPPRWS 26 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R + SI + PG PL LERPPPRWS Sbjct: 27 RSTVSISLISNSCSPGDPLVLERPPPRWS 55 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 II + PG PL LERPPPRWS Sbjct: 85 IIQTSNSCSPGDPLVLERPPPRWS 108 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R + SI + PG PL LERPPPRWS Sbjct: 26 RSTVSISLISNSCSPGDPLVLERPPPRWS 54 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R + SI + PG PL LERPPPRWS Sbjct: 24 RSTVSISLISNSCSPGDPLVLERPPPRWS 52 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -2 Query: 103 LYEKRDSTSIISR-AEXXQPGHPLXLERPPPRWS 5 + EK ++ II + + PG PL LERPPPRWS Sbjct: 1 MIEKFENFGIIPKPSNSCSPGDPLVLERPPPRWS 34 >SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 IS + PG PL LERPPPRWS Sbjct: 40 ISTSNSCSPGDPLVLERPPPRWS 62 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 T+ I + PG PL LERPPPRWS Sbjct: 178 TTTIPPSNSCSPGDPLVLERPPPRWS 203 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +R+ PG PL LERPPPRWS Sbjct: 9 TRSNSCSPGDPLVLERPPPRWS 30 >SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 ST + A PG PL LERPPPRWS Sbjct: 53 STKGVQLAARAGPGDPLVLERPPPRWS 79 >SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) Length = 889 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R E PG PL LERPPPRWS Sbjct: 102 RQEDVLPGDPLVLERPPPRWS 122 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S + R+ PG PL LERPPPRWS Sbjct: 552 SKILSDRSNSCSPGDPLVLERPPPRWS 578 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 S S + PG PL LERPPPRWS Sbjct: 15 SFFSPSNSCSPGDPLVLERPPPRWS 39 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 +S + PG PL LERPPPRWS Sbjct: 12 VSSSNSCSPGDPLVLERPPPRWS 34 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +R+ PG PL LERPPPRWS Sbjct: 4 NRSNSCSPGDPLVLERPPPRWS 25 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -2 Query: 103 LYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 L ++ D I + PG PL LERPPPRWS Sbjct: 2 LEQQSDRPHIHRASNSCSPGDPLVLERPPPRWS 34 >SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +I + PG PL LERPPPRWS Sbjct: 2 VIDTSNSCSPGDPLVLERPPPRWS 25 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -2 Query: 100 YEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 Y + T+ + PG PL LERPPPRWS Sbjct: 33 YTQTPPTTYAEPSNSCSPGDPLVLERPPPRWS 64 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +R+ PG PL LERPPPRWS Sbjct: 9 TRSNSCSPGDPLVLERPPPRWS 30 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +R+ PG PL LERPPPRWS Sbjct: 2 TRSNSCSPGDPLVLERPPPRWS 23 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +R+ PG PL LERPPPRWS Sbjct: 44 ARSNSCSPGDPLVLERPPPRWS 65 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.020 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +IIS + PG PL LERPPPRWS Sbjct: 10 SANIIS-SNSCSPGDPLVLERPPPRWS 35 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = -2 Query: 100 YEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 Y + DS + PG PL LERPPPRWS Sbjct: 7 YFEPDSNQRPRESNSCSPGDPLVLERPPPRWS 38 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 +S + PG PL LERPPPRWS Sbjct: 89 VSTSNSCSPGDPLVLERPPPRWS 111 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S++ PG PL LERPPPRWS Sbjct: 3 SKSNSCSPGDPLVLERPPPRWS 24 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +R+ PG PL LERPPPRWS Sbjct: 7 ARSNSCSPGDPLVLERPPPRWS 28 >SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 88 DSTSIISRAEXXQPGHPLXLERPPPRWS 5 D I+ + PG PL LERPPPRWS Sbjct: 6 DLIYILDTSNSCSPGDPLVLERPPPRWS 33 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 + R+ PG PL LERPPPRWS Sbjct: 53 LMRSNSCSPGDPLVLERPPPRWS 75 >SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I + + PG PL LERPPPRWS Sbjct: 10 SANIRNTSNSCSPGDPLVLERPPPRWS 36 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +I + PG PL LERPPPRWS Sbjct: 11 VIKTSNSCSPGDPLVLERPPPRWS 34 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.1 bits (82), Expect = 0.020 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 STS IS + PG PL LERPPPRWS Sbjct: 2 STSKISNS--CSPGDPLVLERPPPRWS 26 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -2 Query: 94 KRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 +R S I + PG PL LERPPPRWS Sbjct: 4 QRGRASDIVASNSCSPGDPLVLERPPPRWS 33 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -2 Query: 103 LYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 +Y+ + S + + PG PL LERPPPRWS Sbjct: 8 VYKIKMSRKVSITSNSCSPGDPLVLERPPPRWS 40 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.020 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 + R+ PG PL LERPPPRWS Sbjct: 3 VVRSNSCSPGDPLVLERPPPRWS 25 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I + PG PL LERPPPRWS Sbjct: 10 SANISQTSNSCSPGDPLVLERPPPRWS 36 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -2 Query: 103 LYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 L R + + + PG PL LERPPPRWS Sbjct: 89 LISHRQTNKSLKISNSCSPGDPLVLERPPPRWS 121 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 381 RSNSCSPGDPLVLERPPPRWS 401 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 I+ + PG PL LERPPPRWS Sbjct: 19 INESNSCSPGDPLVLERPPPRWS 41 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 21 RSNSCSPGDPLVLERPPPRWS 41 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I + PG PL LERPPPRWS Sbjct: 10 SANICFTSNSCSPGDPLVLERPPPRWS 36 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 10 RSNSCSPGDPLVLERPPPRWS 30 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R+ +++ + PG PL LERPPPRWS Sbjct: 2 RNYNAVLFVSNSCSPGDPLVLERPPPRWS 30 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 +S + PG PL LERPPPRWS Sbjct: 4 LSASNSCSPGDPLVLERPPPRWS 26 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 39 RSNSCSPGDPLVLERPPPRWS 59 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 + S I + PG PL LERPPPRWS Sbjct: 26 KKSQDISKTSNSCSPGDPLVLERPPPRWS 54 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 22 RSNSCSPGDPLVLERPPPRWS 42 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 4 RSNSCSPGDPLVLERPPPRWS 24 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 66 RSNSCSPGDPLVLERPPPRWS 86 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 36.7 bits (81), Expect = 0.026 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +++ + PG PL LERPPPRWS Sbjct: 11 VLNSSNSCSPGDPLVLERPPPRWS 34 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I + + PG PL LERPPPRWS Sbjct: 10 SANIKAGSNSCSPGDPLVLERPPPRWS 36 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 69 RSNSCSPGDPLVLERPPPRWS 89 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 ++S + PG PL LERPPPRWS Sbjct: 1 MLSLSNSCSPGDPLVLERPPPRWS 24 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 110 RSNSCSPGDPLVLERPPPRWS 130 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 31 RSNSCSPGDPLVLERPPPRWS 51 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 6 RSNSCSPGDPLVLERPPPRWS 26 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R +I + PG PL LERPPPRWS Sbjct: 27 RTQKPVIFLSNSCSPGDPLVLERPPPRWS 55 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 17 RSNSCSPGDPLVLERPPPRWS 37 >SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +I + PG PL LERPPPRWS Sbjct: 6 VIQGSNSCSPGDPLVLERPPPRWS 29 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +IIS + PG PL LERPPPRWS Sbjct: 10 SANIISNS--CSPGDPLVLERPPPRWS 34 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -2 Query: 94 KRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 +R S+IS + PG PL LERPPPRWS Sbjct: 27 RRYRVSLISNS--CSPGDPLVLERPPPRWS 54 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 54 RSNSCSPGDPLVLERPPPRWS 74 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 7 RSNSCSPGDPLVLERPPPRWS 27 >SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) Length = 208 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 ++ E PG PL LERPPPRWS Sbjct: 82 LVEIIEKANPGDPLVLERPPPRWS 105 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -2 Query: 118 NY*ARLYEKRDSTSIISR--AEXXQPGHPLXLERPPPRWS 5 NY L ++ + +I S + PG PL LERPPPRWS Sbjct: 13 NYKHVLLDRHEHVTICSYRISNSCSPGDPLVLERPPPRWS 52 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 44 RSNSCSPGDPLVLERPPPRWS 64 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 11 RSNSCSPGDPLVLERPPPRWS 31 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -2 Query: 61 EXXQPGHPLXLERPPPRWS 5 E +PG PL LERPPPRWS Sbjct: 192 EVLRPGDPLVLERPPPRWS 210 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 17 RSNSCSPGDPLVLERPPPRWS 37 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 59 RSNSCSPGDPLVLERPPPRWS 79 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 322 RSNSCSPGDPLVLERPPPRWS 342 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 IS + PG PL LERPPPRWS Sbjct: 13 ISVSNSCSPGDPLVLERPPPRWS 35 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 16 RSNSCSPGDPLVLERPPPRWS 36 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 25 RSNSCSPGDPLVLERPPPRWS 45 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 60 RSNSCSPGDPLVLERPPPRWS 80 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 5 RSNSCSPGDPLVLERPPPRWS 25 >SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) Length = 345 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 ST+ + PG PL LERPPPRWS Sbjct: 215 STTFWGLSNSCSPGDPLVLERPPPRWS 241 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 7 RSNSCSPGDPLVLERPPPRWS 27 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 14 RSNSCSPGDPLVLERPPPRWS 34 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 ST I+S + PG PL LERPPPRWS Sbjct: 101 STFILSNS--CSPGDPLVLERPPPRWS 125 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 14 RSNSCSPGDPLVLERPPPRWS 34 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 54 RSNSCSPGDPLVLERPPPRWS 74 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 31 RSNSCSPGDPLVLERPPPRWS 51 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 214 RSNSCSPGDPLVLERPPPRWS 234 >SB_11224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/28 (60%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = -2 Query: 82 TSIISRAEXXQ--PGHPLXLERPPPRWS 5 TS+I R PG PL LERPPPRWS Sbjct: 34 TSVIGREPVLSQCPGDPLVLERPPPRWS 61 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 19 RSNSCSPGDPLVLERPPPRWS 39 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +IIS + PG PL LERPPPRWS Sbjct: 10 SANIISNS--CSPGDPLVLERPPPRWS 34 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 1 RSNSCSPGDPLVLERPPPRWS 21 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 5 RSNSCSPGDPLVLERPPPRWS 25 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 +I S + PG PL LERPPPRWS Sbjct: 29 TIHSASNSCSPGDPLVLERPPPRWS 53 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 35 RSNSCSPGDPLVLERPPPRWS 55 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R+ PG PL LERPPPRWS Sbjct: 21 RSNSCSPGDPLVLERPPPRWS 41 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +++ + PG PL LERPPPRWS Sbjct: 27 LLTASNSCSPGDPLVLERPPPRWS 50 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.035 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I + PG PL LERPPPRWS Sbjct: 10 SANIGKTSNSCSPGDPLVLERPPPRWS 36 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.035 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 +S I+ + PG PL LERPPPRWS Sbjct: 4 SSPITISNSCSPGDPLVLERPPPRWS 29 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 36.3 bits (80), Expect = 0.035 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = -2 Query: 136 LRAQQTNY*ARLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 LR + T + R + D+ + + PG PL LERPPPRWS Sbjct: 98 LRGRDTTF-QRRFTASDTNEV---SNSCSPGDPLVLERPPPRWS 137 >SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) Length = 386 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 261 SNVKALSPGDPLVLERPPPRWS 282 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 36.3 bits (80), Expect = 0.035 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -2 Query: 109 ARLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 ++ KR +S S + PG PL LERPPPRWS Sbjct: 54 SKFRRKRRKSSTTSNS--CSPGDPLVLERPPPRWS 86 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +I + PG PL LERPPPRWS Sbjct: 5 VIFTSNSCSPGDPLVLERPPPRWS 28 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 I+ + PG PL LERPPPRWS Sbjct: 13 INSSNSCSPGDPLVLERPPPRWS 35 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 + S + PG PL LERPPPRWS Sbjct: 2 VTSPSNSCSPGDPLVLERPPPRWS 25 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 +S + PG PL LERPPPRWS Sbjct: 53 LSPSNSCSPGDPLVLERPPPRWS 75 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.3 bits (80), Expect = 0.035 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -2 Query: 100 YEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 Y + I + PG PL LERPPPRWS Sbjct: 8 YIREKLQGYIRESNSCSPGDPLVLERPPPRWS 39 >SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 I + PG PL LERPPPRWS Sbjct: 543 IQESNSCSPGDPLVLERPPPRWS 565 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 I+ + PG PL LERPPPRWS Sbjct: 250 INASNSCSPGDPLVLERPPPRWS 272 >SB_35386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 36.3 bits (80), Expect = 0.035 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R+ + A PG PL LERPPPRWS Sbjct: 14 RNFIDMALEASDYSPGDPLVLERPPPRWS 42 >SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +R + PG PL LERPPPRWS Sbjct: 95 TRNDKITPGDPLVLERPPPRWS 116 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 T++ + PG PL LERPPPRWS Sbjct: 8 TNVSYTSNSCSPGDPLVLERPPPRWS 33 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 52 SESNSCSPGDPLVLERPPPRWS 73 >SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 + A PG PL LERPPPRWS Sbjct: 4 THAHSCSPGDPLVLERPPPRWS 25 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +++ + PG PL LERPPPRWS Sbjct: 40 LLNASNSCSPGDPLVLERPPPRWS 63 >SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) Length = 999 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 Query: 61 EXXQPGHPLXLERPPPRWS 5 E PG PL LERPPPRWS Sbjct: 693 ENVNPGDPLVLERPPPRWS 711 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I+S + PG PL LERPPPRWS Sbjct: 10 SANIVSNS--CSPGDPLVLERPPPRWS 34 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 I+ + PG PL LERPPPRWS Sbjct: 14 IVYTSNSCSPGDPLVLERPPPRWS 37 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.9 bits (79), Expect = 0.046 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 88 DSTSIISR-AEXXQPGHPLXLERPPPRWS 5 + S++ R + PG PL LERPPPRWS Sbjct: 18 NGASLVPRPSNSCSPGDPLVLERPPPRWS 46 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 SI+S + PG PL LERPPPRWS Sbjct: 346 SIVSNS--CSPGDPLVLERPPPRWS 368 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 85 STSIISR--AEXXQPGHPLXLERPPPRWS 5 S +I+S + PG PL LERPPPRWS Sbjct: 10 SANIVSHNTSNSCSPGDPLVLERPPPRWS 38 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 18 STSNSCSPGDPLVLERPPPRWS 39 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 64 AEXXQPGHPLXLERPPPRWS 5 A PG PL LERPPPRWS Sbjct: 44 ARLESPGDPLVLERPPPRWS 63 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 9 STSNSCSPGDPLVLERPPPRWS 30 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 ++ + PG PL LERPPPRWS Sbjct: 44 VVVTSNSCSPGDPLVLERPPPRWS 67 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 ++ + PG PL LERPPPRWS Sbjct: 11 VTSSNSCSPGDPLVLERPPPRWS 33 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 S +I+S + PG PL LERPPPRWS Sbjct: 10 SANILSNS--CSPGDPLVLERPPPRWS 34 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.9 bits (79), Expect = 0.046 Identities = 19/42 (45%), Positives = 23/42 (54%) Frame = -2 Query: 130 AQQTNY*ARLYEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 A + Y R Y +R S + + PG PL LERPPPRWS Sbjct: 2 APRIYYIGRGYLRRGSQTA---SNSCSPGDPLVLERPPPRWS 40 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 52 SASNSCSPGDPLVLERPPPRWS 73 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 202 SSSNSCSPGDPLVLERPPPRWS 223 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 41 SSSNSCSPGDPLVLERPPPRWS 62 >SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) Length = 487 Score = 35.9 bits (79), Expect = 0.046 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 I S PG PL LERPPPRWS Sbjct: 58 IASPINDRNPGDPLVLERPPPRWS 81 >SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.9 bits (79), Expect = 0.046 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = -2 Query: 97 EKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 + R+ T I+R PG PL LERPPPRWS Sbjct: 21 DARNCTIQITRQR--SPGDPLVLERPPPRWS 49 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 S+ ++ PG PL LERPPPRWS Sbjct: 7 SLSYQSNSCSPGDPLVLERPPPRWS 31 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 I+ + PG PL LERPPPRWS Sbjct: 76 ILLTSNSCSPGDPLVLERPPPRWS 99 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 I + PG PL LERPPPRWS Sbjct: 8 IKTSNSCSPGDPLVLERPPPRWS 30 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 11 SASNSCSPGDPLVLERPPPRWS 32 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +I + PG PL LERPPPRWS Sbjct: 19 VIYPSNSCSPGDPLVLERPPPRWS 42 >SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 + ++ +PG PL LERPPPRWS Sbjct: 24 MEQSNSCRPGDPLVLERPPPRWS 46 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 + ++ PG PL LERPPPRWS Sbjct: 186 LCKSNSCSPGDPLVLERPPPRWS 208 >SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -2 Query: 85 STSIISRAEXXQPGHPLXLERPPPRWS 5 ++ + S + PG PL LERPPPRWS Sbjct: 14 ASGLHSGSNSCSPGDPLVLERPPPRWS 40 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 +I+ + PG PL LERPPPRWS Sbjct: 2 AILFLSNSCSPGDPLVLERPPPRWS 26 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 5 SSSNSCSPGDPLVLERPPPRWS 26 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.9 bits (79), Expect = 0.046 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R+ST S + PG PL LERPPPRWS Sbjct: 19 RESTPFGSNS--CSPGDPLVLERPPPRWS 45 >SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 I+ + PG PL LERPPPRWS Sbjct: 13 ITGSNSCSPGDPLVLERPPPRWS 35 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 35.9 bits (79), Expect = 0.046 Identities = 15/29 (51%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -2 Query: 88 DSTSIISR-AEXXQPGHPLXLERPPPRWS 5 D+ S+ ++ + PG PL LERPPPRWS Sbjct: 27 DTISLATKTSNSCSPGDPLVLERPPPRWS 55 >SB_42354| Best HMM Match : GETHR (HMM E-Value=5.3) Length = 162 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R +PG PL LERPPPRWS Sbjct: 38 RHSTTRPGDPLVLERPPPRWS 58 >SB_41271| Best HMM Match : EGF (HMM E-Value=1.2e-20) Length = 169 Score = 35.9 bits (79), Expect = 0.046 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 127 QQTNY*ARLYEKRDSTSIISRAEXXQ-PGHPLXLERPPPRWS 5 ++ N R+ + D +S + E PG PL LERPPPRWS Sbjct: 85 RRNNQDGRVVKALDLSSNVRGFEPHSCPGDPLVLERPPPRWS 126 >SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) Length = 129 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S + PG PL LERPPPRWS Sbjct: 4 STSNSCSPGDPLVLERPPPRWS 25 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 +I+ + PG PL LERPPPRWS Sbjct: 2 TIVIISNSCSPGDPLVLERPPPRWS 26 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 ++ + PG PL LERPPPRWS Sbjct: 22 VAASNSCSPGDPLVLERPPPRWS 44 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 I + PG PL LERPPPRWS Sbjct: 37 IKASNSCSPGDPLVLERPPPRWS 59 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +++ PG PL LERPPPRWS Sbjct: 17 AKSNSCSPGDPLVLERPPPRWS 38 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 35.9 bits (79), Expect = 0.046 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = -2 Query: 79 SIISR-AEXXQPGHPLXLERPPPRWS 5 ++IS+ + PG PL LERPPPRWS Sbjct: 5 NVISKTSNSCSPGDPLVLERPPPRWS 30 >SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 T + + PG PL LERPPPRWS Sbjct: 15 TDLYWESNSCSPGDPLVLERPPPRWS 40 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 I + + PG PL LERPPPRWS Sbjct: 18 ICAASNSCSPGDPLVLERPPPRWS 41 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +++ PG PL LERPPPRWS Sbjct: 27 AKSNSCSPGDPLVLERPPPRWS 48 >SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) Length = 720 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R PG PL LERPPPRWS Sbjct: 596 RRSNINPGDPLVLERPPPRWS 616 >SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) Length = 716 Score = 35.9 bits (79), Expect = 0.046 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 91 RDSTSIISRAEXXQPGHPLXLERPPPRWS 5 R+ I + PG PL LERPPPRWS Sbjct: 259 REELEEIVGSNSCSPGDPLVLERPPPRWS 287 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -2 Query: 100 YEKRDSTSIISRAEXXQPGHPLXLERPPPRWS 5 YE + + S + PG PL LERPPPRWS Sbjct: 42 YENKRRVYVTSNS--CSPGDPLVLERPPPRWS 71 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.9 bits (79), Expect = 0.046 Identities = 17/28 (60%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -2 Query: 85 STSIISR-AEXXQPGHPLXLERPPPRWS 5 STS + R + PG PL LERPPPRWS Sbjct: 2 STSKMLRVSNSCSPGDPLVLERPPPRWS 29 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +I + PG PL LERPPPRWS Sbjct: 11 LIRLSNSCSPGDPLVLERPPPRWS 34 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 +++ + PG PL LERPPPRWS Sbjct: 65 TMVIESNSCSPGDPLVLERPPPRWS 89 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 +++ + PG PL LERPPPRWS Sbjct: 68 VMTPSNSCSPGDPLVLERPPPRWS 91 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.060 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 ++ PG PL LERPPPRWS Sbjct: 11 KSNSCSPGDPLVLERPPPRWS 31 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 67 RAEXXQPGHPLXLERPPPRWS 5 R PG PL LERPPPRWS Sbjct: 12 RRAWKSPGDPLVLERPPPRWS 32 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 85 STSIISR--AEXXQPGHPLXLERPPPRWS 5 S S +SR + PG PL LERPPPRWS Sbjct: 73 SQSPLSRFTSNSCSPGDPLVLERPPPRWS 101 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.060 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 +++ PG PL LERPPPRWS Sbjct: 5 TQSNSCSPGDPLVLERPPPRWS 26 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 S+ PG PL LERPPPRWS Sbjct: 59 SKLSSTGPGDPLVLERPPPRWS 80 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -2 Query: 79 SIISRAEXXQPGHPLXLERPPPRWS 5 S ++ PG PL LERPPPRWS Sbjct: 174 SAVTNQLSANPGDPLVLERPPPRWS 198 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.060 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 52 QPGHPLXLERPPPRWS 5 +PG PL LERPPPRWS Sbjct: 26 RPGDPLVLERPPPRWS 41 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = -2 Query: 88 DSTSIISRAEXXQPGHPLXLERPPPRWS 5 ++TS S + PG PL LERPPPRWS Sbjct: 9 NNTSFTSNS--CSPGDPLVLERPPPRWS 34 >SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) Length = 352 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 ++ A PG PL LERPPPRWS Sbjct: 149 LLLHAFHENPGDPLVLERPPPRWS 172 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.5 bits (78), Expect = 0.060 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 82 TSIISRAEXXQPGHPLXLERPPPRWS 5 T ++S + PG PL LERPPPRWS Sbjct: 10 TKVLSNS--CSPGDPLVLERPPPRWS 33 >SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.060 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 70 SRAEXXQPGHPLXLERPPPRWS 5 ++ + PG PL LERPPPRWS Sbjct: 31 TQCKVPSPGDPLVLERPPPRWS 52 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 76 IISRAEXXQPGHPLXLERPPPRWS 5 I+S + PG PL LERPPP WS Sbjct: 14 IVSISNSCSPGEPLVLERPPPPWS 37 >SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 Query: 73 ISRAEXXQPGHPLXLERPPPRWS 5 +S PG PL LERPPPRWS Sbjct: 38 MSSRRKKSPGDPLVLERPPPRWS 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,571,466 Number of Sequences: 59808 Number of extensions: 253810 Number of successful extensions: 1746 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1746 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -