BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0068.Seq (978 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54338| Best HMM Match : Ligase_CoA (HMM E-Value=0) 36 0.066 SB_4556| Best HMM Match : zf-C3HC4 (HMM E-Value=3.5) 29 5.7 SB_13324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 >SB_54338| Best HMM Match : Ligase_CoA (HMM E-Value=0) Length = 445 Score = 35.5 bits (78), Expect = 0.066 Identities = 21/54 (38%), Positives = 26/54 (48%) Frame = +1 Query: 592 KLVGPNCPGIIAPEECXNWXXASWQSXXXXXHXALVSRSGXIEPNEACHXTTYY 753 +L+GPNCPG+I P EC +VSRSG + EA TT Y Sbjct: 14 RLIGPNCPGVITPGECKIGIMPG--HIHLPGKVGIVSRSGTL-TYEAVKQTTDY 64 >SB_4556| Best HMM Match : zf-C3HC4 (HMM E-Value=3.5) Length = 199 Score = 29.1 bits (62), Expect = 5.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 145 CQCRVLSKFKDGLKTRQCTICI 210 C C+V S++ D K R C +C+ Sbjct: 18 CDCKVASQWADAEKVRLCEVCV 39 >SB_13324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 793 PSNXDTTKVWPKPSNK*SXDRLHWVQXPQNGIPTP 689 PS D K + P N + R W Q P + +P P Sbjct: 113 PSTEDECKAFRYPQNSPNGTRATWKQFPSHDLPPP 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,820,632 Number of Sequences: 59808 Number of extensions: 422357 Number of successful extensions: 1523 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1523 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2895879843 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -