BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0059.Seq (299 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 22 5.7 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 21 7.6 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/39 (28%), Positives = 16/39 (41%) Frame = -1 Query: 194 C*PHDAIIRLSHXSDSPTDNIHFRCVSSTTCGGVYVSNH 78 C H ++ +S T N +S +C GV S H Sbjct: 22 CSCHSSVCAVSFVMQCSTCNAPTDSANSVSCAGVCGSKH 60 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 73 CTEAWSLAWMRRL 35 C++A AWMRRL Sbjct: 298 CSKAEKPAWMRRL 310 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 250,714 Number of Sequences: 2352 Number of extensions: 3435 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19123236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -