BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0056.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosacc... 27 2.6 SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomy... 27 3.4 >SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1121 Score = 27.1 bits (57), Expect = 2.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 85 VINWDETKWNGMRWTHNVR 141 ++ D+T+WNGMR T VR Sbjct: 959 LLETDKTEWNGMRLTGEVR 977 >SPAC1B3.13 |||U3 snoRNP-associated protein Nan1|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 26.6 bits (56), Expect = 3.4 Identities = 11/50 (22%), Positives = 20/50 (40%) Frame = +1 Query: 52 NEMKMTNLNA*VINWDETKWNGMRWTHNVRDTILDGSXGISSLEDRRRNH 201 N++ N +++W NG+ W N + G G+ L +H Sbjct: 246 NDISNEKFNPQILHWHANPLNGLSWALNGEYLLSGGQEGVLVLWQMETSH 295 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,399,024 Number of Sequences: 5004 Number of extensions: 41279 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -