BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0055.Seq (797 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 27 0.89 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 24 6.3 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 26.6 bits (56), Expect = 0.89 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 150 GXATDASDPYLATWLQYRAHGKKHNDAQSHQRPPGNNP 263 G ATD ++ LA Q + H +H Q HQ+ ++P Sbjct: 293 GSATDNNNYILAQQQQQQHHHHQHQPQQQHQQQYHSHP 330 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 309 RSQRCP*CVATVSRGLDCXQVVFDGFAH 226 ++Q C C A V GL+C Q + FA+ Sbjct: 25 QAQTCRNCAAPVHHGLNCVQNRQNRFAN 52 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,418 Number of Sequences: 2352 Number of extensions: 12442 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -