BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0037x.Seq (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132865-5|CAB60597.1| 258|Caenorhabditis elegans Hypothetical ... 28 4.4 AC084152-2|AAM69073.2| 1571|Caenorhabditis elegans Hypothetical ... 27 7.7 >AL132865-5|CAB60597.1| 258|Caenorhabditis elegans Hypothetical protein Y62E10A.8 protein. Length = 258 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +3 Query: 276 DDFDEDSEQCLRGLKAPXXXSQXKCRAXTYLHXSKVXXLAXGKEXXXPFLIC 431 DD DED E L GLKA K A + + + + +L+C Sbjct: 99 DDEDEDFEMTLEGLKAKRLREMRKIAANRVIEMTDKKQYSDAVDGSSSYLLC 150 >AC084152-2|AAM69073.2| 1571|Caenorhabditis elegans Hypothetical protein Y102A11A.3 protein. Length = 1571 Score = 27.5 bits (58), Expect = 7.7 Identities = 21/72 (29%), Positives = 32/72 (44%) Frame = +3 Query: 156 QCFVKISTTGSESRRTENMRLEAQGGVSMD*FPVELVGGADDFDEDSEQCLRGLKAPXXX 335 Q + +S +S R E + + VS+D + AD +ED LR L AP Sbjct: 418 QMVMSVSREFQQSHREEASQAKTSELVSLDLQLLTYASKADQIEEDPRLMLRRL-APRKT 476 Query: 336 SQXKCRAXTYLH 371 S K ++ T L+ Sbjct: 477 SVDKWKSSTLLN 488 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,278,488 Number of Sequences: 27780 Number of extensions: 139107 Number of successful extensions: 293 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 293 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -