BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0025.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0136 + 18478227-18478254,18478514-18479113,18479344-18479684 29 3.2 10_08_0469 + 18149039-18149420,18149537-18149649 28 7.4 >01_05_0136 + 18478227-18478254,18478514-18479113,18479344-18479684 Length = 322 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 263 WPKLIFSLVVVYVSFPYYCDKLSRNRVVGIFGKYFTYRCT 144 WP+L+F+ V +F Y DK S + G F Y+ T Sbjct: 29 WPRLVFTRPCVAATFRYGLDKESATNLDISVGGSFAYKIT 68 >10_08_0469 + 18149039-18149420,18149537-18149649 Length = 164 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 156 VSLYYYCIFLSGFSNGYSDFVSLTCTTNCYF 64 +S++YYCI+L F + F+S + T+ F Sbjct: 131 ISMFYYCIWLKQFYSSVETFLSGSETSETIF 161 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,740,056 Number of Sequences: 37544 Number of extensions: 260701 Number of successful extensions: 475 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -