BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0014.Seq (827 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016448-1|AAB65956.2| 477|Caenorhabditis elegans Temporarily a... 36 0.027 Z92812-8|CAB07275.1| 337|Caenorhabditis elegans Hypothetical pr... 33 0.33 AL033510-6|CAA22062.1| 343|Caenorhabditis elegans Hypothetical ... 30 1.8 Z80344-2|CAB02487.3| 608|Caenorhabditis elegans Hypothetical pr... 29 3.1 >AF016448-1|AAB65956.2| 477|Caenorhabditis elegans Temporarily assigned gene nameprotein 196 protein. Length = 477 Score = 36.3 bits (80), Expect = 0.027 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +3 Query: 507 PSRWTGGSTGAVXDIKXQGKXGSFWAFSTTG 599 P + GAV +K QG GS WAFSTTG Sbjct: 265 PESFDWREKGAVTQVKNQGNCGSCWAFSTTG 295 >Z92812-8|CAB07275.1| 337|Caenorhabditis elegans Hypothetical protein T03E6.7 protein. Length = 337 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 Query: 531 TGAVXDIKXQGKXGSFWAFSTTG 599 T V D+K QG GS WAFS TG Sbjct: 129 THLVTDVKNQGMCGSCWAFSATG 151 >AL033510-6|CAA22062.1| 343|Caenorhabditis elegans Hypothetical protein Y40H7A.10 protein. Length = 343 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 531 TGAVXDIKXQGKXGSFWAFSTTGXFXXXXGISXQGRLXLXS 653 T V IK QG GS WAF+T IS G L S Sbjct: 147 TNHVTGIKYQGPCGSCWAFATAAAIESAVSISGGGLQSLSS 187 >Z80344-2|CAB02487.3| 608|Caenorhabditis elegans Hypothetical protein F15D4.4 protein. Length = 608 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 267 RMKIYAEHXHIIAKHNQKYEMGLVXYKLGMNKY 365 R +Y++ + +HN YE+G+ YK+ N++ Sbjct: 154 RFNVYSKVKKEVDEHNIMYELGMSSYKMSTNQF 186 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,697,701 Number of Sequences: 27780 Number of extensions: 172924 Number of successful extensions: 255 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2050970610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -