BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1244 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 27 0.16 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 24 1.1 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 24 1.1 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 24 1.1 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 24 1.1 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 3.4 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 4.4 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 27.1 bits (57), Expect = 0.16 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +1 Query: 163 HANTFQRAKHILELPDSKILTLQFDKNSLTMNGTISTLQNSKRTFCRNSIIKL 321 H N + + ++ DSK+ TL N +T +S + + F N+ I L Sbjct: 579 HGNFIESLGNYYKIRDSKVKTLDASHNRITELSPLSVPDSVELLFINNNYINL 631 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 24.2 bits (50), Expect = 1.1 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +3 Query: 390 VHVDEFLDSDDSSKEVFQSLLDYGVAFITG-----VQPSAEATETCAK 518 ++VDE L SD F+ L+D G G V P A AT+ C K Sbjct: 32 INVDEILHSDRLLNNYFKCLMDEGRCTAEGNELKRVLPDALATD-CKK 78 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +2 Query: 482 ATKRGSYRNVCKALGGIQHTIFGATWEFTTV 574 A G ++ V K G IFG W F+ + Sbjct: 41 APAEGKFKTVSKVPGPFSLPIFGTRWIFSCI 71 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 24.2 bits (50), Expect = 1.1 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +3 Query: 390 VHVDEFLDSDDSSKEVFQSLLDYGVAFITG-----VQPSAEATETCAK 518 ++VDE L SD F+ L+D G G V P A AT+ C K Sbjct: 32 INVDEILHSDRLLNNYFKCLMDEGRCTAEGNELKRVLPDALATD-CKK 78 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 24.2 bits (50), Expect = 1.1 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +3 Query: 390 VHVDEFLDSDDSSKEVFQSLLDYGVAFITG-----VQPSAEATETCAK 518 ++VDE L SD F+ L+D G G V P A AT+ C K Sbjct: 32 INVDEILHSDRLLNNYFKCLMDEGRCTAEGNELKRVLPDALATD-CKK 78 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 272 VLIVPFIVRLFLSNCNVSIFESGSSKMCLAL 180 V + F+VR CN + S +C+AL Sbjct: 62 VCVAVFLVRKLRRPCNYLLVSLAVSDLCVAL 92 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.2 bits (45), Expect = 4.4 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 172 TFQRAKHILELPDSKILTLQFDKNSLTMNGTISTLQ-NSKRTF 297 TF+ K+++ D +TLQ KN++ T S++ +RTF Sbjct: 517 TFREQKNLMIELDKFPITLQPGKNTIEQKSTKSSVTIPFERTF 559 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,003 Number of Sequences: 438 Number of extensions: 3565 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -